StarFunc result for job id Q8N6F7

User Input

>input (178 residues)
MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDS
QNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRES
LGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:Q8N6F7	1.000	1.000	2.518E-29	178	1.000	1.000	Q8N6F7.pdb.gz	GCSAM_HUMAN Germinal center-associated signaling and motility protein OS=Homo sapiens OX=9606 GN=GCSAM PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N6F7	1.72e-133	372	178	1.000	1.000	GCSAM_HUMAN Germinal center-associated signaling and motility protein OS=Homo sapiens OX=9606 GN=GCSAM PE=1 SV=1
2	Q5JQS6	4.18e-10	57.0	135	0.208	0.274	GSAML_HUMAN Germinal center-associated signaling and motility-like protein OS=Homo sapiens OX=9606 GN=GCSAML PE=1 SV=1
3	Q6ZNM6	0.75	31.6	134	0.073	0.097	SMI10_HUMAN Sperm-associated microtubule inner protein 10 OS=Homo sapiens OX=9606 GN=SPMIP10 PE=1 SV=1
4	Q9D9I1	2.4	30.0	141	0.073	0.092	SMI10_MOUSE Sperm-associated microtubule inner protein 10 OS=Mus musculus OX=10090 GN=Spmip10 PE=1 SV=2
5	Q8I2P2	5.1	30.0	839	0.096	0.020	Q8I2P2_PLAF7 Glutamine-dependent NAD(+) synthetase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0926700 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14983 DUF4513	1.2e+02	14.1	Domain of unknown function (DUF4513)
2	PF15666 HGAL	3e-39	144.3	Germinal center-associated lymphoma

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419485

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376345	0.813	Growth factor receptor-bound protein 2
2	9606.ENSP00000313571	0.704	Lectin, galactoside-binding, soluble, 7B
3	9606.ENSP00000367891	0.704	Galectin-7
4	9606.ENSP00000339958	0.642	Nischarin
5	9606.ENSP00000257818	0.620	Rhombotin-2
6	9606.ENSP00000384371	0.603	B-cell lymphoma 6 protein
7	9606.ENSP00000337133	0.567	Serpin A9
8	9606.ENSP00000323435	0.542	Sorting nexin-22
9	9606.ENSP00000263038	0.512	Phytanoyl-CoA dioxygenase, peroxisomal
10	9606.ENSP00000418525	0.508	Neprilysin
11	9606.ENSP00000215909	0.504	Galectin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0045159	1.000	myosin II binding
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	1.000	regulation of cellular process
GO:0048583	0.992	regulation of response to stimulus
GO:0002682	0.989	regulation of immune system process
GO:0050776	0.979	regulation of immune response
GO:0048523	0.978	negative regulation of cellular process
GO:0023051	0.975	regulation of signaling
GO:0010646	0.975	regulation of cell communication
GO:0009966	0.951	regulation of signal transduction
GO:0071675	0.857	regulation of mononuclear cell migration
GO:0050854	0.851	regulation of antigen receptor-mediated signaling pathway
GO:0002683	0.846	negative regulation of immune system process
GO:2000401	0.841	regulation of lymphocyte migration
GO:0009987	0.743	cellular process
GO:0040013	0.738	negative regulation of locomotion
GO:2000146	0.724	negative regulation of cell motility
GO:0048518	0.690	positive regulation of biological process
GO:0030336	0.684	negative regulation of cell migration
GO:0002686	0.657	negative regulation of leukocyte migration
GO:0050896	0.489	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.997	organelle
GO:0043227	0.992	membrane-bounded organelle
GO:0005622	0.991	intracellular anatomical structure
GO:0043229	0.949	intracellular organelle
GO:0005737	0.892	cytoplasm
GO:0043231	0.827	intracellular membrane-bounded organelle
GO:0005576	0.764	extracellular region
GO:0005615	0.742	extracellular space
GO:0070062	0.725	extracellular exosome
GO:0032991	0.621	protein-containing complex
GO:0005634	0.322	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]