StarFunc result for job id Q8N6G5

User Input

>input (542 residues)
MPRRGLILHTRTHWLLLGLALLCSLVLFMYLLECAPQTDGNASLPGVVGENYGKEYYQAL
LQEQEEHYQTRATSLKRQIAQLKQELQEMSEKMRSLQERRNVGANGIGYQSNKEQAPSDL
LEFLHSQIDKAEVSIGAKLPSEYGVIPFESFTLMKVFQLEMGLTRHPEEKPVRKDKRDEL
VEVIEAGLEVINNPDEDDEQEDEEGPLGEKLIFNENDFVEGYYRTERDKGTQYELFFKKA
DLTEYRHVTLFRPFGPLMKVKSEMIDITRSIINIIVPLAERTEAFVQFMQNFRDVCIHQD
KKIHLTVVYFGKEGLSKVKSILESVTSESNFHNYTLVSLNEEFNRGRGLNVGARAWDKGE
VLMFFCDVDIYFSAEFLNSCRLNAEPGKKVFYPVVFSLYNPAIVYANQEVPPPVEQQLVH
KKDSGFWRDFGFGMTCQYRSDFLTIGGFDMEVKGWGGEDVHLYRKYLHGDLIVIRTPVPG
LFHLWHEKRCADELTPEQYRMCIQSKAMNEASHSHLGMLVFREEIETHLHKQAYRTNSEA
VG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C1F4	0.892	0.892	2.074E-100	542	0.926	0.926	Q8C1F4.pdb.gz	CGAT2_MOUSE Chondroitin sulfate N-acetylgalactosaminyltransferase 2 OS=Mus musculus OX=10090 GN=Csgalnact2 PE=2 SV=1
2	AFDB:A8E7C8	0.837	0.840	7.190E-86	540	0.729	0.731	A8E7C8.pdb.gz
3	AFDB:E7F6G2	0.808	0.757	2.129E-76	580	0.570	0.533	E7F6G2.pdb.gz	E7F6G2_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=csgalnact1a PE=3 SV=1
4	AFDB:Q8TDX6	0.825	0.840	3.411E-76	532	0.590	0.602	Q8TDX6.pdb.gz	CGAT1_HUMAN Chondroitin sulfate N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=CSGALNACT1 PE=1 SV=2
5	AFDB:A0A0S2Z5K4	0.556	0.710	3.873E-63	416	0.714	0.930	A0A0S2Z5K4.pdb.gz	A0A0S2Z5K4_HUMAN Hexosyltransferase OS=Homo sapiens OX=9606 GN=CSGALNACT2 PE=1 SV=1
6	AFDB:A1Z863	0.716	0.718	9.570E-53	540	0.375	0.376	A1Z863.pdb.gz	A1Z863_DROME Hexosyltransferase OS=Drosophila melanogaster OX=7227 GN=Csgalnact PE=2 SV=1
7	AFDB:Q86X52	0.470	0.323	3.080E-34	802	0.201	0.136	Q86X52.pdb.gz	CHSS1_HUMAN Chondroitin sulfate synthase 1 OS=Homo sapiens OX=9606 GN=CHSY1 PE=1 SV=3
8	AFDB:Q5DTK1	0.454	0.285	3.898E-34	884	0.232	0.143	Q5DTK1.pdb.gz	CHSS3_MOUSE Chondroitin sulfate synthase 3 OS=Mus musculus OX=10090 GN=Chsy3 PE=2 SV=3
9	AFDB:Q6P296	0.466	0.321	4.386E-34	801	0.212	0.144	Q6P296.pdb.gz	Q6P296_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=chys1 PE=2 SV=1
10	AFDB:Q7Z1Z1	0.441	0.329	2.137E-31	736	0.192	0.141	Q7Z1Z1.pdb.gz	CHSSA_CAEEL Chondroitin sulfate synthase sqv-5 OS=Caenorhabditis elegans OX=6239 GN=sqv-5 PE=1 SV=1
11	PDB:2d7iA	0.293	0.296	1.522E-8	536	0.066	0.067	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
12	PDB:4d0tA	0.283	0.307	6.643E-8	496	0.063	0.069	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
13	PDB:6h0bB	0.289	0.300	1.348E-7	521	0.068	0.071	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
14	PDB:6pxuB	0.286	0.291	1.429E-7	532	0.068	0.070	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
15	PDB:4d11C	0.265	0.323	1.919E-7	436	0.061	0.076	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
16	PDB:6iwqA	0.292	0.290	1.602E-6	546	0.055	0.055	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
17	PDB:4fixA	0.282	0.248	2.420E-6	629	0.076	0.065	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
18	PDB:5mlzA	0.251	0.367	2.888E-6	355	0.044	0.068	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.
19	PDB:4hg6A	0.272	0.206	5.188E-5	747	0.074	0.054	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
20	PDB:5vcsB	0.232	0.363	1.184E-4	323	0.059	0.099	5vcsB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5K4	0.0	796	416	0.723	0.942	A0A0S2Z5K4_HUMAN Hexosyltransferase OS=Homo sapiens OX=9606 GN=CSGALNACT2 PE=1 SV=1
2	E7F6G2	0.0	644	580	0.542	0.507	E7F6G2_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=csgalnact1a PE=3 SV=1
3	Q8BJQ9	0.0	655	530	0.579	0.592	CGAT1_MOUSE Chondroitin sulfate N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Csgalnact1 PE=2 SV=1
4	Q8C1F4	0.0	1021	542	0.926	0.926	CGAT2_MOUSE Chondroitin sulfate N-acetylgalactosaminyltransferase 2 OS=Mus musculus OX=10090 GN=Csgalnact2 PE=2 SV=1
5	Q8N6G5	0.0	1129	542	1.000	1.000	CGAT2_HUMAN Chondroitin sulfate N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=CSGALNACT2 PE=1 SV=1
6	Q8TDX6	0.0	666	532	0.594	0.605	CGAT1_HUMAN Chondroitin sulfate N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=CSGALNACT1 PE=1 SV=2
7	A1Z863	1.09e-114	352	540	0.362	0.363	A1Z863_DROME Hexosyltransferase OS=Drosophila melanogaster OX=7227 GN=Csgalnact PE=2 SV=1
8	Q5DTK1	9.58e-55	200	884	0.186	0.114	CHSS3_MOUSE Chondroitin sulfate synthase 3 OS=Mus musculus OX=10090 GN=Chsy3 PE=2 SV=3
9	Q70JA7	1.10e-53	197	882	0.181	0.111	CHSS3_HUMAN Chondroitin sulfate synthase 3 OS=Homo sapiens OX=9606 GN=CHSY3 PE=2 SV=3
10	Q6ZQ11	5.53e-50	186	800	0.164	0.111	CHSS1_MOUSE Chondroitin sulfate synthase 1 OS=Mus musculus OX=10090 GN=Chsy1 PE=2 SV=2
11	Q6P296	4.77e-48	180	801	0.166	0.112	Q6P296_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=chys1 PE=2 SV=1
12	Q86X52	1.72e-47	179	802	0.168	0.113	CHSS1_HUMAN Chondroitin sulfate synthase 1 OS=Homo sapiens OX=9606 GN=CHSY1 PE=1 SV=3
13	D3ZRM3	5.76e-46	174	799	0.161	0.109	D3ZRM3_RAT Hexosyltransferase OS=Rattus norvegicus OX=10116 GN=Chsy1 PE=3 SV=3
14	Q7Z1Z1	1.14e-36	147	736	0.173	0.128	CHSSA_CAEEL Chondroitin sulfate synthase sqv-5 OS=Caenorhabditis elegans OX=6239 GN=sqv-5 PE=1 SV=1
15	Q6L9W6	8.01e-17	86.7	998	0.107	0.058	B4GN3_HUMAN Beta-1,4-N-acetylgalactosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B4GALNT3 PE=1 SV=2
16	Q76KP1	7.41e-15	80.1	1039	0.107	0.056	B4GN4_HUMAN N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALNT4 PE=1 SV=1
17	Q8IZ52	2.08e-12	72.4	775	0.166	0.116	CHSS2_HUMAN Chondroitin sulfate synthase 2 OS=Homo sapiens OX=9606 GN=CHPF PE=1 SV=2
18	Q6IQX7	3.56e-10	65.1	774	0.162	0.114	CHSS2_MOUSE Chondroitin sulfate synthase 2 OS=Mus musculus OX=10090 GN=Chpf PE=1 SV=1
19	Q8VCJ5	2.18e-06	52.8	551	0.172	0.169	Q8VCJ5_MOUSE Hexosyltransferase (Fragment) OS=Mus musculus OX=10090 GN=Chpf2 PE=2 SV=1
20	Q3UU43	2.63e-06	52.8	768	0.172	0.121	Q3UU43_MOUSE Hexosyltransferase OS=Mus musculus OX=10090 GN=Chpf2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05679 CHGN	1.7e-79	279.6	Chondroitin N-acetylgalactosaminyltransferase
2	PF18504 Csm1_N	3.7e+02	12.9	Csm1 N-terminal domain
3	PF10111 Glyco_tranf_2_2	1.5	19.8	Glycosyltransferase like family 2
4	PF02709 Glyco_transf_7C	0.00018	32.5	N-terminal domain of galactosyltransferase
5	PF11740 KfrA_N	11	18.1	Plasmid replication region DNA-binding N-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363590

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265471	0.967	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
2	9606.ENSP00000035307	0.938	Chondroitin sulfate glucuronyltransferase
3	9606.ENSP00000243776	0.937	Chondroitin sulfate synthase 2
4	9606.ENSP00000254190	0.929	Chondroitin sulfate synthase 1
5	9606.ENSP00000327336	0.929	Biglycan
6	9606.ENSP00000252575	0.918	Neurocan core protein
7	9606.ENSP00000265077	0.918	Versican core protein
8	9606.ENSP00000052754	0.913	Decorin
9	9606.ENSP00000331210	0.913	Brevican core protein
10	9606.ENSP00000312506	0.911	Chondroitin sulfate proteoglycan 4
11	9606.ENSP00000302629	0.910	Chondroitin sulfate synthase 3
12	9606.ENSP00000373244	0.900	Chondroitin sulfate proteoglycan 5
13	9606.ENSP00000411816	0.885	Chondroitin sulfate N-acetylgalactosaminyltransferase 1
14	9606.ENSP00000307297	0.798	Carbohydrate sulfotransferase 14
15	9606.ENSP00000276055	0.793	Carbohydrate sulfotransferase 7
16	9606.ENSP00000305725	0.759	Carbohydrate sulfotransferase 11
17	9606.ENSP00000376141	0.714	Major facilitator superfamily domain containing 6
18	9606.ENSP00000481912	0.712	Carbohydrate sulfotransferase 12
19	9606.ENSP00000393675	0.708	Mitoguardin 1
20	9606.ENSP00000376103	0.684	Protein C19orf12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047238	1.000	glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006790	0.995	sulfur compound metabolic process
GO:0050650	0.995	chondroitin sulfate proteoglycan biosynthetic process
GO:0044272	0.993	sulfur compound biosynthetic process
GO:0006024	0.989	glycosaminoglycan biosynthetic process
GO:1903510	0.985	mucopolysaccharide metabolic process
GO:0030204	0.950	chondroitin sulfate metabolic process
GO:0016051	0.924	carbohydrate biosynthetic process
GO:0034637	0.806	cellular carbohydrate biosynthetic process
GO:0033692	0.774	cellular polysaccharide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.996	membrane
GO:0031090	0.976	organelle membrane
GO:0000139	0.914	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.175	1.000	acetylgalactosaminyltransferase.

[back to server]