StarFunc result for job id Q8N6G6

User Input

>input (1762 residues)
MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRC
LSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCS
LKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNG
DGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENS
LSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHR
WRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCP
ASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKC
MYTPKMPIAQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKP
HIKEECIVPTPCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGV
GTQVRIVRCQVLLSFSQSVADLPIDECEGPKPASQRACYAGPCSGEIPEFNPDETDGLFG
GLQDFDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTREPAEENLCVTSRRPPQLLKS
CNLDPCPARWEIGKWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILADELCRQPKPSTV
QACNRFNCPPAWYPAQWQPCSRTCGGGVQKREVLCKQRMADGSFLELPETFCSASKPACQ
QACKKDDCPSEWLLSDWTECSTSCGEGTQTRSAICRKMLKTGLSTVVNSTLCPPLPFSSS
IRPCMLATCARPGRPSTKHSPHIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCP
ARRVRKPLITWEKDGQHLISSTHVTVAPFGYLKIHRLKPSDAGVYTCSAGPAREHFVIKL
IGGNRKLVARPLSPRSEEEVLAGRKGGPKEALQTHKHQNGIFSNGSKAEKRGLAANPGSR
YDDLVSRLLEQGGWPGELLASWEAQDSAERNTTSEEDPGAEQVLLHLPFTMVTEQRRLDD
ILGNLSQQPEELRDLYSKHLVAQLAQEIFRSHLEHQDTLLKPSERRTSPVTLSPHKHVSG
FSSSLRTSSTGDAGGGSRRPHRKPTILRKISAAQQLSASEVVTHLGQTVALASGTLSVLL
HCEAIGHPRPTISWARNGEEVQFSDRILLQPDDSLQILAPVEADVGFYTCNATNALGYDS
VSIAVTLAGKPLVKTSRMTVINTEKPAVTVDIGSTIKTVQGVNVTINCQVAGVPEAEVTW
FRNKSKLGSPHHLHEGSLLLTNVSSSDQGLYSCRAANLHGELTESTQLLILDPPQVPTQL
EDIRALLAATGPNLPSVLTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTA
TGLTHHILAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYWWSVDRLATCS
ASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRS
CGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQLCVEWAFSSWGQCNG
PCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTA
TCGNYGFQSRRVECVHARTNKAVPEHLCSWGPRPANWQRCNITPCENMECRDTTRYCEKV
KQLKLCQLSQFKSRCCGTCGKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P82987	0.167	0.174	0.000	1691	0.422	0.439	P82987.pdb.gz	ATL3_HUMAN ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=ADAMTSL3 PE=1 SV=4
2	AFDB:Q8BLI0	0.190	0.191	0.000	1745	0.904	0.912	Q8BLI0.pdb.gz	ATL1_MOUSE ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=Adamtsl1 PE=2 SV=2
3	AFDB:Q8N6G6	1.000	1.000	0.000	1762	1.000	1.000	Q8N6G6.pdb.gz	ATL1_HUMAN ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=ADAMTSL1 PE=1 SV=4
4	AFDB:Q0E8N3	0.109	0.133	1.934E-81	1394	0.229	0.290	Q0E8N3.pdb.gz	Q0E8N3_DROME No long nerve cord, isoform C OS=Drosophila melanogaster OX=7227 GN=nolo PE=1 SV=1
5	AFDB:Q19791	0.132	0.110	8.418E-70	2150	0.194	0.159	Q19791.pdb.gz	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
6	AFDB:Q9P2N4	0.140	0.129	3.771E-65	1935	0.166	0.151	Q9P2N4.pdb.gz	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
7	AFDB:Q9EPX2	0.135	0.179	8.448E-64	1280	0.180	0.248	Q9EPX2.pdb.gz	PPN_MOUSE Papilin OS=Mus musculus OX=10090 GN=Papln PE=2 SV=2
8	AFDB:P59511	0.151	0.141	4.037E-61	1906	0.174	0.161	P59511.pdb.gz	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
9	AFDB:E9PUN6	0.139	0.128	1.774E-60	1931	0.159	0.145	E9PUN6.pdb.gz	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
10	AFDB:P59510	0.138	0.128	9.060E-57	1910	0.180	0.166	P59510.pdb.gz	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
11	PDB:5oj2B	0.106	0.230	3.296E-16	692	0.069	0.175	5oj2B.pdb.gz
12	PDB:6dldD	0.078	0.373	2.154E-12	269	0.028	0.186	6dldD.pdb.gz
13	PDB:6dlfA	0.065	0.361	3.416E-11	236	0.027	0.203	6dlfA.pdb.gz
14	PDB:1w0rA	0.041	0.128	1.829E-10	442	0.059	0.235	1w0rA.pdb.gz
15	PDB:1e07A	0.091	0.203	1.193E-9	642	0.041	0.114	1e07A.pdb.gz
16	PDB:6feyB	0.068	0.441	4.834E-8	207	0.026	0.222	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
17	PDB:6feyD	0.059	0.528	1.833E-7	160	0.023	0.256	6feyD.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
18	PDB:7sqcO0	0.070	0.096	3.313E-7	1140	0.061	0.094	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:3o3uN	0.075	0.204	3.842E-7	580	0.023	0.069	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
20	PDB:4lnvA	0.059	0.074	4.037E-7	1276	0.030	0.041	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P82987	0.0	1289	1691	0.402	0.419	ATL3_HUMAN ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=ADAMTSL3 PE=1 SV=4
2	Q8BLI0	0.0	3240	1745	0.902	0.911	ATL1_MOUSE ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=Adamtsl1 PE=2 SV=2
3	Q8N6G6	0.0	3631	1762	1.000	1.000	ATL1_HUMAN ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=ADAMTSL1 PE=1 SV=4
4	P59511	2.77e-81	300	1906	0.155	0.143	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
5	Q19791	9.00e-79	292	2150	0.146	0.120	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
6	H2L2A7	2.08e-77	288	2165	0.146	0.119	H2L2A7_CAEEL Peptidase M12B domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=1
7	P59510	4.06e-75	280	1910	0.158	0.146	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
8	F1SFS3	7.18e-72	270	2000	0.141	0.124	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
9	Q9H324	9.20e-72	265	1103	0.103	0.164	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
10	Q9UKP5	3.00e-71	264	1117	0.106	0.167	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
11	Q4VC17	7.08e-71	264	1219	0.117	0.169	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
12	E9PUN6	7.72e-71	266	1931	0.140	0.127	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
13	Q9P2N4	8.73e-71	266	1935	0.141	0.129	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
14	D3Z1A5	1.18e-70	262	1117	0.107	0.169	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
15	Q9EPX2	2.45e-70	263	1280	0.102	0.141	PPN_MOUSE Papilin OS=Mus musculus OX=10090 GN=Papln PE=2 SV=2
16	E9PYV8	4.00e-70	262	1350	0.140	0.182	E9PYV8_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
17	Q868Z9	1.80e-69	262	2898	0.120	0.073	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
18	O76840	2.56e-67	255	2167	0.123	0.100	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
19	Q69Z28	2.88e-67	253	1222	0.118	0.170	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
20	Q8TE60	1.38e-66	250	1221	0.112	0.161	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19236 ADAMTS_CR_3	2.2e-06	39.0	ADAMTS cysteine-rich domain
2	PF05986 ADAMTS_spacer1	0.035	25.8	ADAM-TS Spacer 1
3	PF07679 I-set	1.5e-43	158.1	Immunoglobulin I-set domain
4	PF00047 ig	2e-21	87.3	Immunoglobulin domain
5	PF13895 Ig_2	1.4e-26	103.9	Immunoglobulin domain
6	PF13927 Ig_3	3.9e-43	157.2	Immunoglobulin domain
7	PF17736 Ig_C17orf99	6.4	18.2	C17orf99 Ig domain
8	PF08686 PLAC	0.00073	31.5	PLAC (protease and lacunin) domain
9	PF19030 TSP1_ADAMTS	1.5e-114	385.5	Thrombospondin type 1 domain
10	PF19035 TSP1_CCN	8.3e-13	59.8	CCN3 Nov like TSP1 domain
11	PF19028 TSP1_spondin	4.3e-05	35.1	Spondin-like TSP1 domain
12	PF00090 TSP_1	8.9e-34	126.7	Thrombospondin type 1 domain
13	PF07686 V-set	2.4e-08	45.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369921

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339613	0.983	GDP-fucose protein O-fucosyltransferase 2
2	9606.ENSP00000343002	0.960	Beta-1,3-glucosyltransferase
3	9606.ENSP00000247153	0.949	Properdin
4	9606.ENSP00000422554	0.937	A disintegrin and metalloproteinase with thrombospondin motifs 12
5	9606.ENSP00000355751	0.935	Thrombospondin-2
6	9606.ENSP00000373472	0.932	A disintegrin and metalloproteinase with thrombospondin motifs 7
7	9606.ENSP00000284984	0.931	A disintegrin and metalloproteinase with thrombospondin motifs 1
8	9606.ENSP00000284987	0.930	A disintegrin and metalloproteinase with thrombospondin motifs 5
9	9606.ENSP00000358035	0.930	ADAMTS-like protein 4
10	9606.ENSP00000346478	0.928	ADAMTS-like protein 2
11	9606.ENSP00000418735	0.925	A disintegrin and metalloproteinase with thrombospondin motifs 9
12	9606.ENSP00000268070	0.924	ADAM metallopeptidase with thrombospondin type 1 motif 17
13	9606.ENSP00000327608	0.924	ADAMTS-like protein 5
14	9606.ENSP00000360997	0.924	A disintegrin and metalloproteinase with thrombospondin motifs 13
15	9606.ENSP00000374071	0.923	A disintegrin and metalloproteinase with thrombospondin motifs 20
16	9606.ENSP00000460236	0.923	Spondin-1
17	9606.ENSP00000270328	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 10
18	9606.ENSP00000274487	0.922	ADAM metallopeptidase with thrombospondin type 1 motif 19
19	9606.ENSP00000370443	0.922	ADAM metallopeptidase with thrombospondin type 1 motif 6
20	9606.ENSP00000299164	0.921	ADAM metallopeptidase with thrombospondin type 1 motif 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071840	0.977	cellular component organization or biogenesis
GO:0032502	0.685	developmental process
GO:0016043	0.663	cellular component organization
GO:0032501	0.523	multicellular organismal process
GO:0050794	0.518	regulation of cellular process
GO:0048856	0.480	anatomical structure development
GO:0050896	0.379	response to stimulus
GO:0071704	0.333	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.995	cell periphery
GO:0012505	0.995	endomembrane system
GO:0005737	0.995	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0031012	0.967	extracellular matrix
GO:0062023	0.950	collagen-containing extracellular matrix
GO:0005783	0.949	endoplasmic reticulum
GO:0005788	0.865	endoplasmic reticulum lumen
GO:0005576	0.469	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]