StarFunc result for job id Q8N6H7

User Input

>input (521 residues)
MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHL
SFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQ
LGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFTEHTQPPAWDAPATEPSGTQQPAPS
TESSGLAQPEHGPNTDLLGTSPKASLELKSSIIGKKKPAAAKKGLGAKKGLGAQKVSSQS
FSEIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQELQIDRKKEEKKLQNLEGKKR
EQAERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRSQLDLFDDVGTFASGPPKYKD
NPFSLGESFGSRWDTDAAWGMDRVEEKEPEVTISSIRPISERATNRREVESRSSGLESSE
ARQKFAGAKAISSDMFFGREVDAEYEARSRLQQLSGSSAISSSDLFGDMDGAHGAGSVSL
GNVLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D8S3	0.299	0.298	2.312E-41	523	0.549	0.547	Q9D8S3.pdb.gz	ARFG3_MOUSE ADP-ribosylation factor GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Arfgap3 PE=1 SV=2
2	AFDB:A0A024R4U0	0.277	0.280	2.184E-39	516	0.555	0.560	A0A024R4U0.pdb.gz
3	AFDB:E9PN48	0.281	0.576	1.598E-34	252	0.457	0.944	E9PN48.pdb.gz	E9PN48_HUMAN ADP ribosylation factor GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=2
4	AFDB:A8JNX0	0.301	0.285	4.981E-34	553	0.397	0.374	A8JNX0.pdb.gz	A8JNX0_DROME ADP-ribosylation factor GTPase activating protein 3, isoform H OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=2
5	AFDB:M9PG88	0.282	0.285	8.547E-31	514	0.390	0.395	M9PG88.pdb.gz	M9PG88_DROME ADP-ribosylation factor GTPase activating protein 3, isoform F OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
6	AFDB:J9VMB5	0.265	0.288	8.304E-20	477	0.301	0.329	J9VMB5.pdb.gz	J9VMB5_CRYNH ADP-ribosylation factor GTPase-activating protein 2/3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_05314 PE=4 SV=1
7	AFDB:O82171	0.237	0.309	1.042E-19	395	0.296	0.390	O82171.pdb.gz	AGD10_ARATH ADP-ribosylation factor GTPase-activating protein AGD10 OS=Arabidopsis thaliana OX=3702 GN=AGD10 PE=2 SV=1
8	AFDB:Q10367	0.319	0.342	2.819E-18	483	0.246	0.265	Q10367.pdb.gz	GLO3_SCHPO ADP-ribosylation factor GTPase-activating protein glo3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=glo3 PE=3 SV=2
9	AFDB:Q9FIQ0	0.235	0.302	1.103E-17	402	0.286	0.371	Q9FIQ0.pdb.gz	AGD9_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD9 OS=Arabidopsis thaliana OX=3702 GN=AGD9 PE=1 SV=1
10	AFDB:P38682	0.288	0.302	1.202E-16	493	0.228	0.241	P38682.pdb.gz	GLO3_YEAST ADP-ribosylation factor GTPase-activating protein GLO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLO3 PE=1 SV=1
11	PDB:3o47A	0.207	0.368	1.980E-11	289	0.096	0.173	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
12	PDB:3ljuX	0.175	0.236	7.318E-7	373	0.073	0.102	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:3lvqE	0.156	0.191	4.387E-5	420	0.073	0.090	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
14	PDB:1u5kA	0.070	0.138	4.386E-1	242	0.035	0.074	1u5kA.pdb.gz	A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
15	PDB:6s1mA	0.063	0.038	3.595	1010	0.033	0.017	6s1mA.pdb.gz	Structure of the processive human Pol delta holoenzyme.
16	PDB:1b67A	0.054	0.274	3.805	68	0.021	0.162	1b67A.pdb.gz
17	PDB:6inhA	0.085	0.096	4.027	450	0.033	0.038	6inhA.pdb.gz	Hydrophobic recognition allows the glycosyltransferase UGT76G1 to catalyze its substrate in two orientations.
18	PDB:2pk9D	0.092	0.174	4.263	219	0.040	0.096	2pk9D.pdb.gz
19	PDB:7qpgB	0.080	0.073	5.996	591	0.046	0.041	7qpgB.pdb.gz
20	PDB:2pv0B	0.059	0.085	6.347	347	0.012	0.017	2pv0B.pdb.gz	DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PIY6	0.0	646	327	0.601	0.957	E9PIY6_HUMAN ADP ribosylation factor GTPase activating protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=1
2	E9PN48	0.0	1070	535	1.000	0.974	E9PN48_HUMAN ADP ribosylation factor GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=2
3	Q8N6H7	0.0	1079	521	1.000	1.000	ARFG2_HUMAN ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=1
4	Q9D8S3	7.38e-174	502	523	0.555	0.553	ARFG3_MOUSE ADP-ribosylation factor GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Arfgap3 PE=1 SV=2
5	Q9NP61	3.40e-173	500	516	0.555	0.560	ARFG3_HUMAN ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3 PE=1 SV=1
6	A8JNX0	4.93e-101	317	553	0.409	0.385	A8JNX0_DROME ADP-ribosylation factor GTPase activating protein 3, isoform H OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=2
7	Q9VNS2	2.24e-100	315	552	0.407	0.384	Q9VNS2_DROME ADP-ribosylation factor GTPase activating protein 3, isoform A OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
8	M9PIL3	4.23e-100	314	549	0.405	0.384	M9PIL3_DROME ADP-ribosylation factor GTPase activating protein 3, isoform G OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
9	M9PG88	1.88e-96	303	514	0.405	0.411	M9PG88_DROME ADP-ribosylation factor GTPase activating protein 3, isoform F OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
10	M9PGG0	3.34e-96	303	513	0.405	0.411	M9PGG0_DROME ADP-ribosylation factor GTPase activating protein 3, isoform E OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
11	Q9FIQ0	3.16e-42	157	402	0.190	0.246	AGD9_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD9 OS=Arabidopsis thaliana OX=3702 GN=AGD9 PE=1 SV=1
12	O82171	6.25e-40	151	395	0.184	0.243	AGD10_ARATH ADP-ribosylation factor GTPase-activating protein AGD10 OS=Arabidopsis thaliana OX=3702 GN=AGD10 PE=2 SV=1
13	Q10367	2.48e-39	151	483	0.144	0.155	GLO3_SCHPO ADP-ribosylation factor GTPase-activating protein glo3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=glo3 PE=3 SV=2
14	Q9M354	1.53e-30	126	459	0.102	0.115	AGD6_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD6 OS=Arabidopsis thaliana OX=3702 GN=AGD6 PE=1 SV=1
15	O80925	8.32e-30	124	456	0.106	0.121	AGD7_ARATH ADP-ribosylation factor GTPase-activating protein AGD7 OS=Arabidopsis thaliana OX=3702 GN=AGD7 PE=1 SV=1
16	P38682	4.32e-29	122	493	0.154	0.162	GLO3_YEAST ADP-ribosylation factor GTPase-activating protein GLO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLO3 PE=1 SV=1
17	Q54DK9	2.42e-26	114	522	0.086	0.086	Q54DK9_DICDI Arf GTPase activating protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292148 PE=4 SV=1
18	M9PFF1	1.47e-25	111	448	0.096	0.112	M9PFF1_DROME ADP-ribosylation factor GTPase activating protein 1, isoform B OS=Drosophila melanogaster OX=7227 GN=ArfGAP1 PE=1 SV=1
19	O94601	1.83e-25	108	321	0.098	0.159	YC8E_SCHPO Uncharacterized protein C622.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC622.14 PE=4 SV=2
20	Q9VTX5	2.04e-25	111	468	0.096	0.107	Q9VTX5_DROME ADP-ribosylation factor GTPase activating protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ArfGAP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01412 ArfGap	4.4e-28	109.1	Putative GTPase activating protein for Arf
2	PF01258 zf-dskA_traR	3.2e+02	12.7	Prokaryotic dksA/traR C4-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000434442

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314615	0.994	ADP-ribosylation factor GTPase-activating protein 1
2	9606.ENSP00000440005	0.957	ADP-ribosylation factor 1
3	9606.ENSP00000249923	0.912	Coatomer subunit beta
4	9606.ENSP00000263245	0.904	ADP-ribosylation factor GTPase-activating protein 3
5	9606.ENSP00000357048	0.890	Coatomer subunit alpha
6	9606.ENSP00000325002	0.879	Coatomer subunit gamma-1
7	9606.ENSP00000402346	0.874	Coatomer subunit gamma-2
8	9606.ENSP00000000233	0.866	ADP-ribosylation factor 5
9	9606.ENSP00000329419	0.864	Coatomer subunit beta
10	9606.ENSP00000306010	0.843	ADP-ribosylation factor 4
11	9606.ENSP00000203630	0.842	Myeloid leukemia factor 2
12	9606.ENSP00000359000	0.842	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
13	9606.ENSP00000256682	0.829	ADP-ribosylation factor 3
14	9606.ENSP00000261636	0.826	ADP-ribosylation factor-like protein 1
15	9606.ENSP00000463393	0.822	Vesicle-trafficking protein SEC22b
16	9606.ENSP00000449270	0.812	Coatomer subunit zeta-1
17	9606.ENSP00000262812	0.794	Coatomer subunit epsilon
18	9606.ENSP00000364945	0.785	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
19	9606.ENSP00000222547	0.750	BET1 homolog
20	9606.ENSP00000264028	0.740	Coatomer subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060589	0.981	nucleoside-triphosphatase regulator activity
GO:0030695	0.971	GTPase regulator activity
GO:0005096	0.950	GTPase activator activity
GO:0097159	0.500	organic cyclic compound binding
GO:1901363	0.497	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.980	cellular process
GO:0051234	0.962	establishment of localization
GO:0006810	0.935	transport
GO:0051641	0.715	cellular localization
GO:0016192	0.530	vesicle-mediated transport
GO:0051649	0.339	establishment of localization in cell
GO:0065007	0.322	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0005794	0.995	Golgi apparatus
GO:0071944	0.993	cell periphery
GO:0005886	0.970	plasma membrane
GO:0031090	0.471	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]