StarFunc result for job id Q8N6I1

User Input

>input (236 residues)
MSKLPADSSVPQTGAANGDRDVPQAEVGRGRREPAPAQPEEAGEGAMAAARGGPVPAARE
GRMAAARAAPAAAARGAPVAAAALARAAAAGRESPAAAAAREARMAEVARLLGEPVDEEG
PEGRPRSRHGNGGLAALPYLRLRHPLSVLGINYQQFLRHYLENYPIAPGRIQELEERRRR
FVEACRAREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N6I1	1.000	1.000	1.454E-35	236	1.000	1.000	Q8N6I1.pdb.gz	EID2_HUMAN EP300-interacting inhibitor of differentiation 2 OS=Homo sapiens OX=9606 GN=EID2 PE=1 SV=3
2	AFDB:P54846	0.137	0.137	6.235E-3	237	0.191	0.190	P54846.pdb.gz	NRL_MOUSE Neural retina-specific leucine zipper protein OS=Mus musculus OX=10090 GN=Nrl PE=1 SV=1
3	AFDB:Q90582	0.144	0.109	1.632E-2	324	0.169	0.123	Q90582.pdb.gz	Q90582_CHICK CCAAT/enhancer-binding protein OS=Gallus gallus OX=9031 GN=cC PE=3 SV=1
4	AFDB:Q93YN8	0.123	0.100	1.749E-2	296	0.161	0.128	Q93YN8.pdb.gz	RMR41_ARATH Remorin 4.1 OS=Arabidopsis thaliana OX=3702 GN=REM4.1 PE=1 SV=1
5	AFDB:Q9M1A4	0.102	0.099	1.749E-2	246	0.174	0.167	Q9M1A4.pdb.gz	Q9M1A4_ARATH Glycine-rich protein OS=Arabidopsis thaliana OX=3702 GN=PSS1 PE=2 SV=1
6	AFDB:P93758	0.148	0.129	3.477E-2	274	0.191	0.164	P93758.pdb.gz	RMR42_ARATH Remorin 4.2 OS=Arabidopsis thaliana OX=3702 GN=REM4.2 PE=1 SV=1
7	AFDB:Q9VS59	0.122	0.138	4.578E-2	201	0.161	0.189	Q9VS59.pdb.gz	AKIRN_DROME Akirin OS=Drosophila melanogaster OX=7227 GN=akirin PE=1 SV=1
8	AFDB:A3KMR8	0.166	0.128	6.456E-2	315	0.144	0.108	A3KMR8.pdb.gz	MAFA_DANRE Transcription factor MafAa OS=Danio rerio OX=7955 GN=mafaa PE=2 SV=1
9	AFDB:P97738	0.134	0.084	6.456E-2	432	0.199	0.109	P97738.pdb.gz	NPTX2_RAT Neuronal pentraxin-2 OS=Rattus norvegicus OX=10116 GN=Nptx2 PE=1 SV=1
10	AFDB:Q96MH2	0.123	0.104	8.499E-2	286	0.220	0.182	Q96MH2.pdb.gz	HEXI2_HUMAN Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1
11	PDB:5lj5O	0.130	0.110	1.809	283	0.093	0.078	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:7mqaNA	0.134	0.111	2.551	295	0.076	0.061	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7ajtCL	0.129	0.049	8.210	781	0.047	0.014	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7egdF	0.073	0.046	8.210	412	0.038	0.022	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N6I1	2.27e-164	455	236	1.000	1.000	EID2_HUMAN EP300-interacting inhibitor of differentiation 2 OS=Homo sapiens OX=9606 GN=EID2 PE=1 SV=3
2	Q96D98	1.20e-16	76.6	161	0.242	0.354	EID2B_HUMAN EP300-interacting inhibitor of differentiation 2B OS=Homo sapiens OX=9606 GN=EID2B PE=1 SV=2
3	Q9Y6B2	1.97e-06	48.9	187	0.110	0.139	EID1_HUMAN EP300-interacting inhibitor of differentiation 1 OS=Homo sapiens OX=9606 GN=EID1 PE=1 SV=1
4	Q9DCR4	1.81e-04	43.1	169	0.106	0.148	EID1_MOUSE EP300-interacting inhibitor of differentiation 1 OS=Mus musculus OX=10090 GN=Eid1 PE=1 SV=2
5	Q6FQ10	0.10	36.2	1618	0.131	0.019	Q6FQ10_CANGA Candida glabrata strain CBS138 chromosome I complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0I10098g PE=4 SV=1
6	Q9EPR5	1.1	32.7	1159	0.110	0.022	SORC2_MOUSE VPS10 domain-containing receptor SorCS2 OS=Mus musculus OX=10090 GN=Sorcs2 PE=1 SV=2
7	A0A2R8Y438	1.6	32.3	944	0.119	0.030	A0A2R8Y438_HUMAN Ankyrin repeat domain containing 11 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=1
8	O54826	1.9	32.0	1068	0.140	0.031	AF10_MOUSE Protein AF-10 OS=Mus musculus OX=10090 GN=Mllt10 PE=1 SV=2
9	Q6UB99	2.6	32.0	2663	0.114	0.010	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
10	F1RLL9	3.1	31.6	1712	0.182	0.025	F1RLL9_PIG Collagen type IV alpha 2 chain OS=Sus scrofa OX=9823 GN=COL4A2 PE=1 SV=3
11	Q57YV2	4.0	30.8	374	0.097	0.061	Q57YV2_TRYB2 HMG box domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.490 PE=4 SV=1
12	P34545	4.8	30.8	2017	0.085	0.010	CBP1_CAEEL Protein cbp-1 OS=Caenorhabditis elegans OX=6239 GN=cbp-1 PE=1 SV=6
13	O94305	5.1	30.4	378	0.097	0.061	MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mgl1 PE=1 SV=1
14	Q96BH1	7.2	30.0	459	0.110	0.057	RNF25_HUMAN E3 ubiquitin-protein ligase RNF25 OS=Homo sapiens OX=9606 GN=RNF25 PE=1 SV=1
15	Q584J1	8.7	30.0	374	0.093	0.059	Q584J1_TRYB2 HMG box domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.660 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375073

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000435619	0.797	EP300-interacting inhibitor of differentiation 3
2	9606.ENSP00000469863	0.694	Dual specificity tyrosine-phosphorylation-regulated kinase 1B
3	9606.ENSP00000332643	0.667	Necdin
4	9606.ENSP00000337473	0.662	Zinc finger protein 324B
5	9606.ENSP00000354957	0.645	Structural maintenance of chromosomes protein 5
6	9606.ENSP00000263253	0.643	Histone acetyltransferase p300
7	9606.ENSP00000354660	0.631	Melanoma-associated antigen C2
8	9606.ENSP00000358019	0.600	Non-structural maintenance of chromosomes element 4 homolog A
9	9606.ENSP00000330694	0.551	Non-structural maintenance of chromosomes element 3 homolog
10	9606.ENSP00000375904	0.514	Galectin-16
11	9606.ENSP00000350934	0.506	Rab GTPase-binding effector protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046332	1.000	SMAD binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0048523	0.977	negative regulation of cellular process
GO:0009892	0.976	negative regulation of metabolic process
GO:0048583	0.973	regulation of response to stimulus
GO:0080090	0.973	regulation of primary metabolic process
GO:0010605	0.968	negative regulation of macromolecule metabolic process
GO:0051172	0.967	negative regulation of nitrogen compound metabolic process
GO:0031324	0.967	negative regulation of cellular metabolic process
GO:0051716	0.963	cellular response to stimulus
GO:0023051	0.963	regulation of signaling
GO:0010646	0.963	regulation of cell communication
GO:0045934	0.962	negative regulation of nucleobase-containing compound metabolic process
GO:1903844	0.950	regulation of cellular response to transforming growth factor beta stimulus
GO:0090092	0.950	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0006355	0.948	regulation of DNA-templated transcription
GO:0016043	0.946	cellular component organization
GO:0007165	0.943	signal transduction
GO:0017015	0.934	regulation of transforming growth factor beta receptor signaling pathway
GO:0007166	0.891	cell surface receptor signaling pathway
GO:0009719	0.879	response to endogenous stimulus
GO:0007178	0.856	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071559	0.834	response to transforming growth factor beta
GO:0071495	0.820	cellular response to endogenous stimulus
GO:0009890	0.807	negative regulation of biosynthetic process
GO:0045892	0.800	negative regulation of DNA-templated transcription
GO:0071363	0.773	cellular response to growth factor stimulus
GO:0071560	0.684	cellular response to transforming growth factor beta stimulus
GO:0007179	0.650	transforming growth factor beta receptor signaling pathway
GO:0048585	0.646	negative regulation of response to stimulus
GO:0010648	0.643	negative regulation of cell communication
GO:0090101	0.612	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030512	0.446	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0043933	0.434	protein-containing complex organization
GO:0022607	0.425	cellular component assembly
GO:0042127	0.355	regulation of cell population proliferation
GO:0048518	0.328	positive regulation of biological process
GO:0065003	0.314	protein-containing complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.930	intracellular non-membrane-bounded organelle
GO:0005737	0.684	cytoplasm
GO:0005829	0.433	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]