StarFunc result for job id Q8N6M3

User Input

>input (262 residues)
MEHLERCEWLLRGTLVRAAVRRYLPWALVASMLAGSLLKELSPLPESYLSNKRNVLNVYF
VKVAWAWTFCLLLPFIALTNYHLTGKAGLVLRRLSTLLVGTAIWYICTSIFSNIEHYTGS
CYQSPALEGVRKEHQSKQQCHQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLHEVKTDR
SHCLHTAITTLVVALGILTFIWVLMFLCTAVYFHNLSQKVFGTLFGLLSWYGTYGFWYPK
AFSPGLPPQSCSLNLKQDSYKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N6M3	1.000	1.000	2.296E-39	262	1.000	1.000	Q8N6M3.pdb.gz	FITM2_HUMAN Acyl-coenzyme A diphosphatase FITM2 OS=Homo sapiens OX=9606 GN=FITM2 PE=1 SV=1
2	AFDB:P59266	0.996	0.996	5.335E-36	262	0.874	0.874	P59266.pdb.gz	FITM2_MOUSE Acyl-coenzyme A diphosphatase FITM2 OS=Mus musculus OX=10090 GN=Fitm2 PE=1 SV=1
3	AFDB:Q52KL1	0.874	0.908	5.581E-20	252	0.443	0.460	Q52KL1.pdb.gz	FITM2_DANRE Acyl-coenzyme A diphosphatase FITM2 OS=Danio rerio OX=7955 GN=fitm2 PE=2 SV=1
4	AFDB:A5D6W6	0.809	0.730	1.667E-14	292	0.313	0.281	A5D6W6.pdb.gz	FITM1_HUMAN Fat storage-inducing transmembrane protein 1 OS=Homo sapiens OX=9606 GN=FITM1 PE=2 SV=1
5	AFDB:Q9VRJ2	0.799	0.501	5.111E-14	423	0.263	0.163	Q9VRJ2.pdb.gz	FITM2_DROME Acyl-coenzyme A diphosphatase FITM2 OS=Drosophila melanogaster OX=7227 GN=Fitm2 PE=1 SV=1
6	AFDB:Q5CZ37	0.790	0.734	4.454E-11	283	0.260	0.240	Q5CZ37.pdb.gz	FITM2_CAEEL Acyl-coenzyme A diphosphatase FITM2 OS=Caenorhabditis elegans OX=6239 GN=fitm-2 PE=3 SV=1
7	AFDB:Q06676	0.540	0.521	4.612E-7	274	0.191	0.182	Q06676.pdb.gz	YFT2_YEAST Acyl-coenzyme A diphosphatase YFT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YFT2 PE=1 SV=1
8	AFDB:Q9HGM4	0.566	0.591	7.020E-7	250	0.191	0.200	Q9HGM4.pdb.gz	SCS3_SCHPO Acyl-coenzyme A diphosphatase fit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fit1 PE=3 SV=1
9	AFDB:P53012	0.548	0.392	9.760E-4	380	0.206	0.142	P53012.pdb.gz	SCS3_YEAST Acyl-coenzyme A diphosphatase SCS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCS3 PE=1 SV=1
10	AFDB:Q9XI60	0.382	0.356	7.162E-2	290	0.156	0.141	Q9XI60.pdb.gz	LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana OX=3702 GN=LPP2 PE=2 SV=1
11	PDB:5jwyA	0.404	0.407	1.549E-1	259	0.111	0.112	5jwyA.pdb.gz	Structural Insight into Substrate Selection and Catalysis of Lipid Phosphate Phosphatase PgpB in the Cell Membrane.
12	PDB:6vqrE	0.179	0.164	7.576E-1	288	0.179	0.163	6vqrE.pdb.gz	Structural basis of transport and inhibition of the Plasmodium falciparum transporter PfFNT.
13	PDB:6x15A	0.166	0.115	8.317E-1	419	0.103	0.064	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
14	PDB:7dskB	0.168	0.115	8.715E-1	464	0.111	0.062	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
15	PDB:7f04C	0.219	0.234	9.131E-1	231	0.137	0.156	7f04C.pdb.gz	Structures of the CcmABCD heme release complex at multiple states.
16	PDB:6jmqA	0.177	0.140	1.002	403	0.118	0.077	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
17	PDB:7ccsB	0.154	0.104	1.050	454	0.149	0.086	7ccsB.pdb.gz
18	PDB:7xp4R	0.155	0.143	1.208	299	0.130	0.114	7xp4R.pdb.gz
19	PDB:6vn7R	0.195	0.194	1.756	263	0.115	0.114	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.
20	PDB:7nd2A	0.235	0.207	1.839	330	0.130	0.103	7nd2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N6M3	0.0	539	262	1.000	1.000	FITM2_HUMAN Acyl-coenzyme A diphosphatase FITM2 OS=Homo sapiens OX=9606 GN=FITM2 PE=1 SV=1
2	P59266	4.70e-175	484	262	0.874	0.874	FITM2_MOUSE Acyl-coenzyme A diphosphatase FITM2 OS=Mus musculus OX=10090 GN=Fitm2 PE=1 SV=1
3	Q52KL1	3.16e-73	226	252	0.439	0.456	FITM2_DANRE Acyl-coenzyme A diphosphatase FITM2 OS=Danio rerio OX=7955 GN=fitm2 PE=2 SV=1
4	Q9VRJ2	1.73e-34	130	423	0.282	0.175	FITM2_DROME Acyl-coenzyme A diphosphatase FITM2 OS=Drosophila melanogaster OX=7227 GN=Fitm2 PE=1 SV=1
5	A5D6W6	2.96e-30	116	292	0.302	0.271	FITM1_HUMAN Fat storage-inducing transmembrane protein 1 OS=Homo sapiens OX=9606 GN=FITM1 PE=2 SV=1
6	Q91V79	7.44e-30	115	292	0.305	0.274	FITM1_MOUSE Fat storage-inducing transmembrane protein 1 OS=Mus musculus OX=10090 GN=Fitm1 PE=1 SV=1
7	Q5CZ37	4.76e-21	91.7	283	0.233	0.216	FITM2_CAEEL Acyl-coenzyme A diphosphatase FITM2 OS=Caenorhabditis elegans OX=6239 GN=fitm-2 PE=3 SV=1
8	Q9HGM4	1.73e-07	53.1	250	0.214	0.224	SCS3_SCHPO Acyl-coenzyme A diphosphatase fit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fit1 PE=3 SV=1
9	Q06676	1.79e-04	44.3	274	0.099	0.095	YFT2_YEAST Acyl-coenzyme A diphosphatase YFT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YFT2 PE=1 SV=1
10	Q5QNN8	0.35	34.3	344	0.092	0.070	Q5QNN8_DANRE Trace amine-associated receptor 12h OS=Danio rerio OX=7955 GN=si:dkey-7c18.22 PE=3 SV=1
11	Q9UKT9	1.4	32.7	509	0.099	0.051	IKZF3_HUMAN Zinc finger protein Aiolos OS=Homo sapiens OX=9606 GN=IKZF3 PE=1 SV=2
12	Q9P7Q9	3.1	31.6	577	0.115	0.052	ALG9_SCHPO Alpha-1,2-mannosyltransferase alg9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg9 PE=3 SV=1
13	A0A0B4KEH8	3.4	31.2	371	0.095	0.067	A0A0B4KEH8_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG40289 PE=4 SV=1
14	Q9W5H8	4.4	31.2	378	0.095	0.066	Q9W5H8_DROME RE60063p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17883 PE=2 SV=1
15	A0A0B4KEC2	4.5	30.8	376	0.095	0.066	A0A0B4KEC2_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG40289 PE=4 SV=1
16	P0AE52	4.6	30.0	156	0.046	0.077	BCP_ECOLI Peroxiredoxin Bcp OS=Escherichia coli (strain K12) OX=83333 GN=bcp PE=1 SV=1
17	P53012	6.0	30.4	380	0.057	0.039	SCS3_YEAST Acyl-coenzyme A diphosphatase SCS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCS3 PE=1 SV=1
18	Q5LJQ4	7.2	30.0	282	0.095	0.089	Q5LJQ4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17883 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15062 ARL6IP6	8.7e+02	11.5	Haemopoietic lineage transmembrane helix
2	PF01569 PAP2	0.51	21.6	PAP2 superfamily
3	PF10261 Scs3p	1.2e-21	88.9	Inositol phospholipid synthesis and fat-storage-inducing TM

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380037

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354032	0.777	Seipin
2	9606.ENSP00000314036	0.722	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
3	9606.ENSP00000217043	0.709	Peptidase inhibitor R3HDML
4	9606.ENSP00000351155	0.648	Atlastin-1
5	9606.ENSP00000287218	0.633	Zinc finger AN1-type containing 3
6	9606.ENSP00000217455	0.604	Acyl-coenzyme A thioesterase 8
7	9606.ENSP00000228027	0.582	Diacylglycerol O-acyltransferase 2
8	9606.ENSP00000373328	0.574	Cell death activator CIDE-3
9	9606.ENSP00000300055	0.570	Perilipin-1
10	9606.ENSP00000380184	0.565	Glycerol-3-phosphate acyltransferase 4
11	9606.ENSP00000391498	0.561	Potassium channel subfamily K member 16
12	9606.ENSP00000318821	0.560	GRIP and coiled-coil domain-containing protein 1
13	9606.ENSP00000302830	0.550	Macrophage erythroblast attacher
14	9606.ENSP00000221957	0.539	Perilipin-3
15	9606.ENSP00000473381	0.512	Ornithine decarboxylase antizyme 1
16	9606.ENSP00000289547	0.506	Niemann-Pick C1-like protein 1
17	9606.ENSP00000418695	0.504	Proteasome 26S subunit, non-ATPase 6
18	9606.ENSP00000363869	0.503	V-set and immunoglobulin domain-containing protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016818	0.998	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0005515	0.997	protein binding
GO:0016462	0.990	pyrophosphatase activity
GO:0008289	0.813	lipid binding
GO:0019992	0.552	diacylglycerol binding
GO:0017129	0.552	triglyceride binding
GO:0106399	0.504	acyl-coenzyme A diphosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0140694	0.992	non-membrane-bounded organelle assembly
GO:0034389	0.991	lipid droplet organization
GO:0019915	0.979	lipid storage
GO:0050789	0.967	regulation of biological process
GO:0055088	0.934	lipid homeostasis
GO:0071704	0.851	organic substance metabolic process
GO:0044238	0.822	primary metabolic process
GO:0044237	0.677	cellular metabolic process
GO:0006629	0.572	lipid metabolic process
GO:0006807	0.553	nitrogen compound metabolic process
GO:0050794	0.465	regulation of cellular process
GO:1901564	0.465	organonitrogen compound metabolic process
GO:1901360	0.460	organic cyclic compound metabolic process
GO:0019637	0.450	organophosphate metabolic process
GO:0044281	0.404	small molecule metabolic process
GO:0006796	0.387	phosphate-containing compound metabolic process
GO:0033875	0.333	ribonucleoside bisphosphate metabolic process
GO:0034032	0.331	purine nucleoside bisphosphate metabolic process
GO:0006790	0.321	sulfur compound metabolic process
GO:0048518	0.301	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0005739	0.502	mitochondrion
GO:0005886	0.325	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.998	In phosphorus-containing anhydrides.
RHEA:50044	0.504	an acyl-CoA + H2O = adenosine 3',5'-bisphosphate + an acyl-4'-phosphopantetheine + 2 H(+)

[back to server]