StarFunc result for job id Q8N6Q3

User Input

>input (437 residues)
MSAVLLLALLGFILPLPGVQALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLM
LIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLW
APQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCM
PQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEV
GQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCN
SASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGATHCYDGYIHLSG
GGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGGGAEGLESLTWGV
GLALAPALWWGVVCPSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N6Q3	1.000	1.000	3.988E-76	437	1.000	1.000	Q8N6Q3.pdb.gz	CD177_HUMAN CD177 antigen OS=Homo sapiens OX=9606 GN=CD177 PE=1 SV=2
2	AFDB:Q9BY14	0.431	0.740	5.388E-15	249	0.165	0.289	Q9BY14.pdb.gz	TX101_HUMAN Testis-expressed protein 101 OS=Homo sapiens OX=9606 GN=TEX101 PE=1 SV=2
3	AFDB:Q7TQN2	0.398	0.666	2.600E-14	253	0.153	0.265	Q7TQN2.pdb.gz	TX101_CRIGR Testis-expressed protein 101 OS=Cricetulus griseus OX=10029 GN=TEX101 PE=2 SV=1
4	AFDB:Q924B5	0.426	0.722	1.316E-13	250	0.156	0.272	Q924B5.pdb.gz	TX101_RAT Testis-expressed protein 101 OS=Rattus norvegicus OX=10116 GN=Tex101 PE=1 SV=1
5	AFDB:Q9JMI7	0.423	0.716	5.005E-13	250	0.137	0.240	Q9JMI7.pdb.gz	TX101_MOUSE Testis-expressed protein 101 OS=Mus musculus OX=10090 GN=Tex101 PE=1 SV=1
6	AFDB:Q6UWN0	0.409	0.699	2.533E-12	246	0.153	0.272	Q6UWN0.pdb.gz	LYPD4_HUMAN Ly6/PLAUR domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LYPD4 PE=2 SV=2
7	AFDB:Q6UWN5	0.330	0.536	6.867E-8	251	0.114	0.199	Q6UWN5.pdb.gz	LYPD5_HUMAN Ly6/PLAUR domain-containing protein 5 OS=Homo sapiens OX=9606 GN=LYPD5 PE=1 SV=2
8	AFDB:P49616	0.174	0.224	2.489E-7	328	0.156	0.207	P49616.pdb.gz	UPAR_RAT Urokinase plasminogen activator surface receptor OS=Rattus norvegicus OX=10116 GN=Plaur PE=2 SV=2
9	AFDB:Q05588	0.169	0.217	3.314E-7	330	0.158	0.209	Q05588.pdb.gz	UPAR_BOVIN Urokinase plasminogen activator surface receptor OS=Bos taurus OX=9913 GN=PLAUR PE=2 SV=1
10	AFDB:O55006	0.205	0.310	1.322E-6	240	0.103	0.188	O55006.pdb.gz	ROB1_RAT Protein RoBo-1 OS=Rattus norvegicus OX=10116 PE=1 SV=1
11	PDB:3laqV	0.171	0.250	3.205E-5	260	0.121	0.204	3laqV.pdb.gz
12	PDB:3bt1U	0.157	0.240	1.278E-4	273	0.130	0.209	3bt1U.pdb.gz
13	PDB:4aq1A	0.101	0.074	4.049E-1	721	0.098	0.060	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:5a42A	0.087	0.042	4.901E-1	1597	0.112	0.031	5a42A.pdb.gz
15	PDB:4nenA	0.087	0.051	5.391E-1	1063	0.059	0.024	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
16	PDB:2n99A	0.119	0.520	5.655E-1	76	0.034	0.197	2n99A.pdb.gz
17	PDB:6wjcC	0.122	0.578	6.525E-1	69	0.034	0.217	6wjcC.pdb.gz	Structure and selectivity engineering of the M1muscarinic receptor toxin complex.
18	PDB:4zqyA	0.091	0.422	2.150	65	0.034	0.231	4zqyA.pdb.gz
19	PDB:1ngwH	0.066	0.106	2.255	216	0.041	0.083	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
20	PDB:7vonA	0.089	0.044	2.602	1399	0.098	0.031	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N6Q3	0.0	885	437	1.000	1.000	CD177_HUMAN CD177 antigen OS=Homo sapiens OX=9606 GN=CD177 PE=1 SV=2
2	Q9BY14	8.30e-30	118	249	0.146	0.257	TX101_HUMAN Testis-expressed protein 101 OS=Homo sapiens OX=9606 GN=TEX101 PE=1 SV=2
3	Q924B5	2.65e-25	105	250	0.160	0.280	TX101_RAT Testis-expressed protein 101 OS=Rattus norvegicus OX=10116 GN=Tex101 PE=1 SV=1
4	Q9JMI7	8.38e-23	99.0	250	0.140	0.244	TX101_MOUSE Testis-expressed protein 101 OS=Mus musculus OX=10090 GN=Tex101 PE=1 SV=1
5	Q7TQN2	1.26e-22	98.6	253	0.140	0.241	TX101_CRIGR Testis-expressed protein 101 OS=Cricetulus griseus OX=10029 GN=TEX101 PE=2 SV=1
6	Q6UWN0	3.49e-19	88.6	246	0.156	0.276	LYPD4_HUMAN Ly6/PLAUR domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LYPD4 PE=2 SV=2
7	O95274	0.91	34.3	346	0.073	0.092	LYPD3_HUMAN Ly6/PLAUR domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LYPD3 PE=1 SV=2
8	Q8BPP5	1.5	32.7	171	0.039	0.099	LYPD6_MOUSE Ly6/PLAUR domain-containing protein 6 OS=Mus musculus OX=10090 GN=Lypd6 PE=1 SV=1
9	D3ZTT2	1.6	32.7	171	0.039	0.099	LYPD6_RAT Ly6/PLAUR domain-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Lypd6 PE=1 SV=2
10	Q86Y78	2.2	32.3	171	0.039	0.099	LYPD6_HUMAN Ly6/PLAUR domain-containing protein 6 OS=Homo sapiens OX=9606 GN=LYPD6 PE=1 SV=1
11	Q66IA6	4.6	31.2	174	0.034	0.086	LYPD6_DANRE Ly6/PLAUR domain-containing protein 6 OS=Danio rerio OX=7955 GN=lypd6 PE=1 SV=1
12	O55006	5.6	31.2	240	0.098	0.179	ROB1_RAT Protein RoBo-1 OS=Rattus norvegicus OX=10116 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00021 UPAR_LY6	7e-17	73.2	u-PAR/Ly-6 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479536

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000457421	0.997	Platelet endothelial cell adhesion molecule
2	9606.ENSP00000234347	0.996	Myeloblastin
3	9606.ENSP00000435637	0.895	Contactin-5
4	9606.ENSP00000441691	0.759	Integrin alpha-M
5	9606.ENSP00000407822	0.751	Contactin-6
6	9606.ENSP00000295225	0.747	Calsenilin
7	9606.ENSP00000339328	0.678	Urokinase plasminogen activator surface receptor
8	9606.ENSP00000331915	0.642	Refilin-B
9	9606.ENSP00000244333	0.639	Ly6/PLAUR domain-containing protein 3
10	9606.ENSP00000216968	0.600	Endothelial protein C receptor
11	9606.ENSP00000292140	0.583	Pleckstrin homology like domain family B member 3
12	9606.ENSP00000315870	0.557	Zinc finger protein 575
13	9606.ENSP00000225275	0.551	Myeloperoxidase
14	9606.ENSP00000219022	0.547	Olfactomedin-4
15	9606.ENSP00000292147	0.537	Persulfide dioxygenase ETHE1, mitochondrial
16	9606.ENSP00000310170	0.536	Fos-related antigen 1
17	9606.ENSP00000231751	0.525	Lactotransferrin
18	9606.ENSP00000430823	0.518	Zinc finger protein 706
19	9606.ENSP00000479240	0.511	Phospholipase A2 inhibitor and LY6/PLAUR domain containing
20	9606.ENSP00000367185	0.508	LY6/PLAUR domain containing 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048306	1.000	calcium-dependent protein binding
GO:0002020	1.000	protease binding
GO:0005178	1.000	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0002376	0.989	immune system process
GO:0050794	0.989	regulation of cellular process
GO:0002682	0.988	regulation of immune system process
GO:0009893	0.985	positive regulation of metabolic process
GO:0048522	0.984	positive regulation of cellular process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0051239	0.978	regulation of multicellular organismal process
GO:0002697	0.976	regulation of immune effector process
GO:0007155	0.971	cell adhesion
GO:0031325	0.970	positive regulation of cellular metabolic process
GO:0098609	0.963	cell-cell adhesion
GO:0048583	0.960	regulation of response to stimulus
GO:0002703	0.960	regulation of leukocyte mediated immunity
GO:0032879	0.956	regulation of localization
GO:0060627	0.953	regulation of vesicle-mediated transport
GO:0050900	0.951	leukocyte migration
GO:0050865	0.947	regulation of cell activation
GO:0002684	0.944	positive regulation of immune system process
GO:0016043	0.938	cellular component organization
GO:0017157	0.926	regulation of exocytosis
GO:1903305	0.910	regulation of regulated secretory pathway
GO:0002886	0.899	regulation of myeloid leukocyte mediated immunity
GO:0051179	0.898	localization
GO:0097529	0.896	myeloid leukocyte migration
GO:0002699	0.892	positive regulation of immune effector process
GO:0045216	0.891	cell-cell junction organization
GO:0097530	0.868	granulocyte migration
GO:0048584	0.860	positive regulation of response to stimulus
GO:0007159	0.856	leukocyte cell-cell adhesion
GO:2000377	0.849	regulation of reactive oxygen species metabolic process
GO:0051050	0.839	positive regulation of transport
GO:0045123	0.838	cellular extravasation
GO:0051641	0.829	cellular localization
GO:0043300	0.822	regulation of leukocyte degranulation
GO:0043954	0.817	cellular component maintenance
GO:0090322	0.804	regulation of superoxide metabolic process
GO:1903532	0.802	positive regulation of secretion by cell
GO:2000379	0.769	positive regulation of reactive oxygen species metabolic process
GO:0045921	0.769	positive regulation of exocytosis
GO:0008104	0.767	protein localization
GO:0050896	0.761	response to stimulus
GO:1990266	0.753	neutrophil migration
GO:0034394	0.750	protein localization to cell surface
GO:1903307	0.740	positive regulation of regulated secretory pathway
GO:0009966	0.712	regulation of signal transduction
GO:0002694	0.701	regulation of leukocyte activation
GO:0032928	0.691	regulation of superoxide anion generation
GO:0043302	0.686	positive regulation of leukocyte degranulation
GO:0051240	0.671	positive regulation of multicellular organismal process
GO:0034331	0.590	cell junction maintenance
GO:0002696	0.570	positive regulation of leukocyte activation
GO:0050776	0.549	regulation of immune response
GO:0050778	0.466	positive regulation of immune response
GO:0002705	0.416	positive regulation of leukocyte mediated immunity
GO:0051128	0.408	regulation of cellular component organization
GO:0098742	0.367	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0032930	0.319	positive regulation of superoxide anion generation
GO:0045217	0.316	cell-cell junction maintenance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0070062	0.996	extracellular exosome
GO:0030667	0.996	secretory granule membrane
GO:0098590	0.982	plasma membrane region
GO:0070820	0.980	tertiary granule
GO:0035579	0.980	specific granule membrane
GO:0045121	0.977	membrane raft
GO:0070821	0.966	tertiary granule membrane
GO:0044853	0.949	plasma membrane raft
GO:0070013	0.609	intracellular organelle lumen
GO:0032991	0.352	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]