StarFunc result for job id Q8N6R0

User Input

>input (699 residues)
MNLLPKSSREFGSVDYWEKFFQQRGKKAFEWYGTYLELCGVLHKYIKPREKVLVIGCGNS
ELSEQLYDVGYRDIVNIDISEVVIKQMKECNATRRPQMSFLKMDMTQMEFPDASFQVVLD
KGTLDAVLTDEEEKTLQQVDRMLAEVGRVLQVGGRYLCISLAQAHILKKAVGHFSREGWM
VRVHQVANSQDQVLEAEPQFSLPVFAFIMTKFRPVPGSALQIFELCAQEQRKPVRLESAE
RLAEAVQERQQYAWLCSQLRRKARLGSVSLDLCDGDTGEPRYTLHVVDSPTVKPSRDNHF
AIFIIPQGRETEWLFGMDEGRKQLAASAGFRRLITVALHRGQQYESMDHIQAELSARVME
LAPAGMPTQQQVPFLSVGGDIGVRTVQHQDCSPLSGDYVIEDVQGDDKRYFRRLIFLSNR
NVVQSEARLLKDVSHKAQKKRKKDRKKQRPADAEDLPAAPGQSIDKSYLCCEHHKAMIAG
LALLRNPELLLEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFS
QSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQK
VKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKL
ATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N6R0	1.000	1.000	0.000	699	1.000	1.000	Q8N6R0.pdb.gz	EFNMT_HUMAN eEF1A lysine and N-terminal methyltransferase OS=Homo sapiens OX=9606 GN=METTL13 PE=1 SV=1
2	AFDB:Q17539	0.823	0.873	7.653E-66	656	0.322	0.343	Q17539.pdb.gz	Q17539_CAEEL Methyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C01B10.8 PE=1 SV=1
3	AFDB:P0DPD7	0.274	0.725	5.857E-19	255	0.094	0.259	P0DPD7.pdb.gz	EFMT4_HUMAN EEF1A lysine methyltransferase 4 OS=Homo sapiens OX=9606 GN=EEF1AKMT4 PE=1 SV=1
4	AFDB:Q57X26	0.343	0.441	4.220E-15	533	0.084	0.111	Q57X26.pdb.gz	Q57X26_TRYB2 Spermidine synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.170 PE=4 SV=1
5	AFDB:Q57XQ9	0.264	0.697	1.648E-14	254	0.090	0.248	Q57XQ9.pdb.gz	Q57XQ9_TRYB2 Methyltransferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.580 PE=4 SV=1
6	AFDB:P0DPE2	0.199	0.158	1.518E-12	883	0.073	0.058	P0DPE2.pdb.gz	EFCE2_BOVIN EEF1AKMT4-ECE2 readthrough transcript protein OS=Bos taurus OX=9913 GN=EEF1AKMT4-ECE2 PE=1 SV=1
7	AFDB:A0A494BZY7	0.237	0.650	7.680E-11	236	0.064	0.191	A0A494BZY7.pdb.gz	A0A494BZY7_HUMAN EEF1A lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EEF1AKMT2 PE=1 SV=1
8	AFDB:Q38BE3	0.305	0.534	1.254E-10	378	0.070	0.130	Q38BE3.pdb.gz	Q38BE3_TRYB2 Spermidine synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2640 PE=4 SV=1
9	AFDB:Q09741	0.263	0.566	1.324E-10	298	0.087	0.205	Q09741.pdb.gz	SPEE_SCHPO Spermidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.07c PE=3 SV=1
10	AFDB:P19623	0.260	0.557	1.837E-10	302	0.082	0.189	P19623.pdb.gz	SPEE_HUMAN Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1
11	PDB:2o06A	0.268	0.577	2.132E-10	297	0.082	0.192	2o06A.pdb.gz	Structure and mechanism of spermidine synthases.
12	PDB:5wp5A	0.158	0.226	2.510E-10	463	0.086	0.130	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
13	PDB:2pt6A	0.263	0.606	7.070E-10	281	0.077	0.192	2pt6A.pdb.gz	Crystal structure of Plasmodium falciparum spermidine synthase in complex with the substrate decarboxylated S-adenosylmethionine and the potent inhibitors 4MCHA and AdoDATO.
14	PDB:5wp4A	0.161	0.224	9.804E-10	485	0.089	0.128	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
15	PDB:3v97B	0.217	0.234	1.601E-9	641	0.097	0.106	3v97B.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
16	PDB:3anxB	0.285	0.584	2.345E-9	313	0.084	0.188	3anxB.pdb.gz	Crystal structures and enzymatic properties of a triamine/agmatine aminopropyltransferase from Thermus thermophilus
17	PDB:3o4fC	0.282	0.620	3.434E-9	284	0.072	0.176	3o4fC.pdb.gz
18	PDB:3v97A	0.220	0.228	5.310E-9	667	0.106	0.111	3v97A.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
19	PDB:6o65B	0.255	0.554	6.973E-9	294	0.076	0.180	6o65B.pdb.gz	Spermidine Synthase (SPDS) Undergoes Concerted Structural Rearrangements Upon Ligand Binding - A Case Study of the Two SPDS Isoforms FromArabidopsis thaliana.
20	PDB:1mjfA	0.255	0.590	9.157E-9	271	0.074	0.192	1mjfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N6R0	0.0	1440	699	1.000	1.000	EFNMT_HUMAN eEF1A lysine and N-terminal methyltransferase OS=Homo sapiens OX=9606 GN=METTL13 PE=1 SV=1
2	Q91YR5	0.0	1234	698	0.900	0.901	EFNMT_MOUSE eEF1A lysine and N-terminal methyltransferase OS=Mus musculus OX=10090 GN=Mettl13 PE=1 SV=1
3	Q17539	2.63e-96	313	656	0.339	0.361	Q17539_CAEEL Methyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C01B10.8 PE=1 SV=1
4	P0DPD7	6.83e-32	126	255	0.093	0.255	EFMT4_HUMAN EEF1A lysine methyltransferase 4 OS=Homo sapiens OX=9606 GN=EEF1AKMT4 PE=1 SV=1
5	P0DPE2	1.07e-20	99.8	883	0.076	0.060	EFCE2_BOVIN EEF1AKMT4-ECE2 readthrough transcript protein OS=Bos taurus OX=9913 GN=EEF1AKMT4-ECE2 PE=1 SV=1
6	Q57XQ9	7.80e-18	85.9	254	0.099	0.272	Q57XQ9_TRYB2 Methyltransferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.580 PE=4 SV=1
7	Q57X26	7.13e-08	58.2	533	0.064	0.084	Q57X26_TRYB2 Spermidine synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.170 PE=4 SV=1
8	A8MUP2	8.79e-07	53.1	240	0.067	0.196	CSKMT_HUMAN Citrate synthase-lysine N-methyltransferase CSKMT, mitochondrial OS=Homo sapiens OX=9606 GN=CSKMT PE=1 SV=1
9	Q12455	4.03e-06	51.6	300	0.054	0.127	SPSY_YEAST Spermine synthase SPE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPE4 PE=1 SV=1
10	Q64674	6.14e-06	51.2	302	0.064	0.149	SPEE_MOUSE Spermidine synthase OS=Mus musculus OX=10090 GN=Srm PE=1 SV=1
11	Q99MI5	1.37e-05	50.1	302	0.063	0.146	Q99MI5_RAT Spermidine synthase OS=Rattus norvegicus OX=10116 GN=Srm PE=1 SV=1
12	M0RCX8	1.64e-05	49.7	321	0.063	0.137	M0RCX8_RAT Spermidine synthase OS=Rattus norvegicus OX=10116 GN=Srm PE=1 SV=1
13	P19623	5.32e-05	48.1	302	0.059	0.136	SPEE_HUMAN Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1
14	Q9ZUB3	8.23e-05	47.8	334	0.064	0.135	SPDS1_ARATH Spermidine synthase 1 OS=Arabidopsis thaliana OX=3702 GN=SPDSYN1 PE=1 SV=1
15	Q5JPI9	1.62e-04	46.6	291	0.060	0.144	EFMT2_HUMAN EEF1A lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EEF1AKMT2 PE=1 SV=2
16	O48661	1.87e-04	46.6	340	0.059	0.121	SPDS2_ARATH Spermidine synthase 2 OS=Arabidopsis thaliana OX=3702 GN=SPDSYN2 PE=1 SV=2
17	A0A494BZY7	2.97e-04	45.4	236	0.056	0.165	A0A494BZY7_HUMAN EEF1A lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EEF1AKMT2 PE=1 SV=1
18	P9WIN3	0.001	43.9	270	0.049	0.126	PHMT_MYCTU Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2952 PE=1 SV=1
19	Q6FWB8	0.002	43.5	293	0.053	0.126	Q6FWB8_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SPE3 PE=3 SV=1
20	F1R3G8	0.003	42.7	289	0.059	0.142	F1R3G8_DANRE Spermidine synthase OS=Danio rerio OX=7955 GN=fa18b03 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	3e-15	68.0	Methyltransferase domain
2	PF08242 Methyltransf_12	0.00071	31.6	Methyltransferase domain
3	PF00891 Methyltransf_2	20	16.0	O-methyltransferase domain
4	PF13489 Methyltransf_23	0.0067	27.7	Methyltransferase domain
5	PF13649 Methyltransf_25	4e-17	74.0	Methyltransferase domain
6	PF13847 Methyltransf_31	1.6e-14	65.4	Methyltransferase domain
7	PF07021 MetW	15	16.7	Methionine biosynthesis protein MetW
8	PF05175 MTS	0.96	20.5	Methyltransferase small domain
9	PF06325 PrmA	2.9e+02	12.3	Ribosomal protein L11 methyltransferase (PrmA)
10	PF01564 Spermine_synth	0.00017	32.5	Spermine/spermidine synthase domain
11	PF05724 TPMT	13	16.9	Thiopurine S-methyltransferase (TPMT)
12	PF01209 Ubie_methyltran	0.6	21.0	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354920

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357829	0.834	EEF1A lysine methyltransferase 2
2	9606.ENSP00000350353	0.801	Electron transfer flavoprotein beta subunit lysine methyltransferase
3	9606.ENSP00000254480	0.795	SWI/SNF complex subunit SMARCC1
4	9606.ENSP00000332448	0.793	Probable inactive tRNA-specific adenosine deaminase-like protein 3
5	9606.ENSP00000371307	0.748	Phospholipid phosphatase 6
6	9606.ENSP00000454380	0.745	Protein FAM173A
7	9606.ENSP00000002125	0.740	Protein arginine methyltransferase NDUFAF7, mitochondrial
8	9606.ENSP00000343629	0.733	Protein PRRC2C
9	9606.ENSP00000248306	0.728	Methyltransferase-like protein 25
10	9606.ENSP00000350874	0.727	Methyltransferase-like protein 9
11	9606.ENSP00000422338	0.725	Protein FAM173B
12	9606.ENSP00000267064	0.724	SWI/SNF complex subunit SMARCC2
13	9606.ENSP00000367346	0.721	Arginine-hydroxylase NDUFAF5, mitochondrial
14	9606.ENSP00000344071	0.718	Methyltransferase-like protein 24
15	9606.ENSP00000415115	0.715	Protein N-lysine methyltransferase METTL21A
16	9606.ENSP00000356702	0.711	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
17	9606.ENSP00000307975	0.701	Histidine protein methyltransferase 1 homolog
18	9606.ENSP00000372206	0.690	EEF1A lysine methyltransferase 1
19	9606.ENSP00000173527	0.689	Isochorismatase domain containing 1
20	9606.ENSP00000303570	0.679	Ankyrin repeat and MYND domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.972	catalytic activity
GO:0016740	0.942	transferase activity
GO:0008168	0.837	methyltransferase activity
GO:0008757	0.635	S-adenosylmethionine-dependent methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.991	regulation of primary metabolic process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0031326	0.987	regulation of cellular biosynthetic process
GO:0010556	0.981	regulation of macromolecule biosynthetic process
GO:0051726	0.978	regulation of cell cycle
GO:0019219	0.977	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.975	negative regulation of cellular process
GO:0010468	0.975	regulation of gene expression
GO:0051252	0.969	regulation of RNA metabolic process
GO:0010564	0.949	regulation of cell cycle process
GO:0045786	0.943	negative regulation of cell cycle
GO:1901987	0.937	regulation of cell cycle phase transition
GO:0031327	0.932	negative regulation of cellular biosynthetic process
GO:1902806	0.930	regulation of cell cycle G1/S phase transition
GO:0006355	0.928	regulation of DNA-templated transcription
GO:0051172	0.923	negative regulation of nitrogen compound metabolic process
GO:0010558	0.919	negative regulation of macromolecule biosynthetic process
GO:0010948	0.918	negative regulation of cell cycle process
GO:1902679	0.908	negative regulation of RNA biosynthetic process
GO:1901988	0.897	negative regulation of cell cycle phase transition
GO:0045892	0.883	negative regulation of DNA-templated transcription
GO:1902807	0.872	negative regulation of cell cycle G1/S phase transition
GO:0006357	0.810	regulation of transcription by RNA polymerase II
GO:0009987	0.708	cellular process
GO:0071704	0.650	organic substance metabolic process
GO:0006807	0.632	nitrogen compound metabolic process
GO:0044238	0.615	primary metabolic process
GO:0043170	0.575	macromolecule metabolic process
GO:0000122	0.483	negative regulation of transcription by RNA polymerase II
GO:0044237	0.468	cellular metabolic process
GO:1901564	0.401	organonitrogen compound metabolic process
GO:0043412	0.382	macromolecule modification
GO:0032259	0.317	methylation
GO:0043414	0.306	macromolecule methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005739	0.997	mitochondrion
GO:0005829	0.795	cytosol
GO:0005654	0.690	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.942	Transferases.
EC:2.1.1.-	0.837	Methyltransferases.

[back to server]