StarFunc result for job id Q8N6S4

User Input

>input (541 residues)
MTGEKIRSLRRDHKPSKEEGDLLEPGDEEAAAALGGTFTRSRIGKGGKACHKIFSNHHHR
LQLKAAPASSNPPGAPALPLHNSSVTANSQSPALLAGTNPVAVVADGGSCPAHYPVHECV
FKGDVRRLSSLIRTHNIGQKDNHGNTPLHLAVMLGNKECAHLLLAHNAPVKVKNAQGWSP
LAEAISYGDRQMITALLRKLKQQSRESVEEKRPRLLKALKELGDFYLELHWDFQSWVPLL
SRILPSDACKIYKQGINIRLDTTLIDFTDMKCQRGDLSFIFNGDAAPSESFVVLDNEQKV
YQRIHHEESEMETEEEVDILMSSDIYSATLSTKSISFTRAQTGWLFREDKTERVGNFLAD
FYLVNGLVLESRKRREHLSEEDILRNKAIMESLSKGGNIMEQNFEPIRRQSLTPPPQNTI
TWEEYISAENGKAPHLGRELVCKESKKTFKATIAMSQEFPLGIELLLNVLEVVAPFKHFN
KLREFVQMKLPPGFPVKLDIPVFPTITATVTFQEFRYDEFDGSIFTIPDDYKEDPSRFPD
L

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N6S4	1.000	1.000	3.212E-97	541	1.000	1.000	Q8N6S4.pdb.gz	AN13C_HUMAN Ankyrin repeat domain-containing protein 13C OS=Homo sapiens OX=9606 GN=ANKRD13C PE=1 SV=2
2	AFDB:Q3ZTS7	0.669	0.617	1.634E-37	590	0.290	0.266	Q3ZTS7.pdb.gz	Q3ZTS7_HUMAN Ankyrin repeat domain 13, isoform CRA_b OS=Homo sapiens OX=9606 GN=ANKRD13 PE=2 SV=1
3	AFDB:A0A024QZ29	0.655	0.570	9.200E-37	626	0.292	0.252	A0A024QZ29.pdb.gz
4	AFDB:Q7K4M9	0.654	0.560	4.002E-34	637	0.242	0.206	Q7K4M9.pdb.gz	Q7K4M9_DROME LD31969p OS=Drosophila melanogaster OX=7227 GN=anon-EST:fe1H12 PE=1 SV=1
5	AFDB:Q6ZTN6	0.500	0.521	2.530E-27	518	0.201	0.210	Q6ZTN6.pdb.gz	AN13D_HUMAN Ankyrin repeat domain-containing protein 13D OS=Homo sapiens OX=9606 GN=ANKRD13D PE=1 SV=3
6	AFDB:Q94CF4	0.587	0.516	1.217E-26	624	0.238	0.207	Q94CF4.pdb.gz	Q94CF4_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At1g62050 PE=1 SV=1
7	AFDB:A0A0R4IA11	0.162	0.155	4.676E-6	563	0.054	0.052	A0A0R4IA11.pdb.gz
8	AFDB:Q90X95	0.155	0.110	1.923E-5	772	0.079	0.056	Q90X95.pdb.gz	Q90X95_XENLA BRCA1 associated RING domain 1 L homeolog OS=Xenopus laevis OX=8355 GN=bard1.L PE=1 SV=1
9	AFDB:Q2IBD4	0.131	0.053	5.202E-5	1649	0.109	0.036	Q2IBD4.pdb.gz	CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cttnbp2 PE=1 SV=1
10	PDB:2w7qA	0.168	0.390	5.837E-5	192	0.055	0.156	2w7qA.pdb.gz
11	AFDB:Q86BG1	0.161	0.085	6.760E-5	1069	0.079	0.040	Q86BG1.pdb.gz	Q86BG1_DROME Ankyrin-repeat, SH3-domain, and Proline-rich-region containing protein, isoform B OS=Drosophila melanogaster OX=7227 GN=ASPP PE=4 SV=1
12	PDB:4oauC	0.154	0.121	6.493E-4	692	0.043	0.033	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
13	PDB:6jd6B	0.119	0.263	7.598E-4	192	0.050	0.141	6jd6B.pdb.gz
14	PDB:2dvwA	0.159	0.366	1.040E-3	229	0.046	0.109	2dvwA.pdb.gz
15	PDB:8cs9A	0.158	0.108	1.352E-3	796	0.044	0.030	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
16	PDB:6v9hC	0.161	0.313	1.667E-3	270	0.048	0.096	6v9hC.pdb.gz
17	PDB:3ehqA	0.154	0.447	1.851E-3	182	0.041	0.121	3ehqA.pdb.gz
18	PDB:7df7B	0.149	0.633	2.405E-3	119	0.035	0.160	7df7B.pdb.gz
19	PDB:1bd8A	0.137	0.437	2.534E-3	156	0.037	0.128	1bd8A.pdb.gz
20	PDB:1wg0A	0.146	0.319	2.814E-3	243	0.043	0.095	1wg0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N6S4	0.0	1124	541	1.000	1.000	AN13C_HUMAN Ankyrin repeat domain-containing protein 13C OS=Homo sapiens OX=9606 GN=ANKRD13C PE=1 SV=2
2	Q3ZTS7	1.60e-77	257	590	0.288	0.264	Q3ZTS7_HUMAN Ankyrin repeat domain 13, isoform CRA_b OS=Homo sapiens OX=9606 GN=ANKRD13 PE=2 SV=1
3	Q8IZ07	1.60e-77	257	590	0.288	0.264	AN13A_HUMAN Ankyrin repeat domain-containing protein 13A OS=Homo sapiens OX=9606 GN=ANKRD13A PE=1 SV=3
4	Q6ZTN6	5.40e-72	243	605	0.275	0.246	AN13D_HUMAN Ankyrin repeat domain-containing protein 13D OS=Homo sapiens OX=9606 GN=ANKRD13D PE=1 SV=3
5	Q86YJ7	3.18e-71	241	626	0.283	0.244	AN13B_HUMAN Ankyrin repeat domain-containing protein 13B OS=Homo sapiens OX=9606 GN=ANKRD13B PE=1 SV=4
6	Q7K4M9	3.61e-54	195	637	0.257	0.218	Q7K4M9_DROME LD31969p OS=Drosophila melanogaster OX=7227 GN=anon-EST:fe1H12 PE=1 SV=1
7	A8DYI9	3.70e-54	195	630	0.257	0.221	A8DYI9_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=anon-EST:fe1H12 PE=1 SV=1
8	Q8IGB6	2.19e-50	184	618	0.251	0.220	Q8IGB6_DROME RH65876p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG15118 PE=2 SV=1
9	A1ZBH1	5.30e-47	175	592	0.237	0.216	A1ZBH1_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=anon-EST:fe1H12 PE=1 SV=1
10	Q94CF4	3.81e-28	120	624	0.161	0.139	Q94CF4_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At1g62050 PE=1 SV=1
11	S4R3U2	7.44e-12	66.2	173	0.068	0.214	S4R3U2_HUMAN Ankyrin repeat domain 13A (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD13A PE=1 SV=1
12	Q54KA7	7.47e-09	60.8	986	0.081	0.045	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
13	A3KGU1	6.72e-08	58.2	1267	0.087	0.037	A3KGU1_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=LOC567533 PE=2 SV=1
14	A0A0R4IYN3	6.79e-08	58.2	1274	0.087	0.037	A0A0R4IYN3_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=si:ch211-155m12.3 PE=3 SV=1
15	Q6PG48	7.59e-07	53.5	330	0.055	0.091	Q6PG48_HUMAN ANKRD12 protein OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=1
16	Q8GZ22	1.03e-06	52.4	240	0.063	0.142	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
17	Q7T3Y0	1.50e-06	49.3	112	0.065	0.312	NARPA_DANRE Notch-regulated ankyrin repeat-containing protein A OS=Danio rerio OX=7955 GN=nrarpa PE=2 SV=1
18	Q6UB98	1.73e-06	53.5	2062	0.055	0.015	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
19	F4JN13	3.65e-06	51.6	350	0.055	0.086	F4JN13_ARATH Ankyrin repeat-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=AKR2 PE=1 SV=1
20	Q9SAR5	3.68e-06	51.6	342	0.055	0.088	AKR2A_ARATH Ankyrin repeat domain-containing protein 2A OS=Arabidopsis thaliana OX=3702 GN=AKR2A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.3e-05	36.6	Ankyrin repeat
2	PF12796 Ank_2	6.9e-07	41.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	5.3e-05	34.2	Ankyrin repeat
4	PF13637 Ank_4	3.7e-05	35.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.012	27.2	Ankyrin repeats (many copies)
6	PF11904 GPCR_chapero_1	6.9e-66	234.4	GPCR-chaperone

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359982

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259030	0.521	Receptor-transporting protein 4
2	9606.ENSP00000308759	0.513	Zinc finger and BTB domain-containing protein 21
3	9606.ENSP00000324741	0.506	Uncharacterized protein C7orf43
4	9606.ENSP00000378427	0.506	UPF0461 protein C5orf24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0051641	0.963	cellular localization
GO:0033036	0.878	macromolecule localization
GO:0009966	0.868	regulation of signal transduction
GO:0008104	0.860	protein localization
GO:0051235	0.808	maintenance of location
GO:0033365	0.794	protein localization to organelle
GO:0045185	0.788	maintenance of protein location
GO:0051651	0.670	maintenance of location in cell
GO:0010469	0.609	regulation of signaling receptor activity
GO:0070972	0.608	protein localization to endoplasmic reticulum
GO:0072595	0.608	maintenance of protein localization in organelle
GO:0010941	0.496	regulation of cell death
GO:0048519	0.390	negative regulation of biological process
GO:0048523	0.379	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.972	endomembrane system
GO:0016020	0.917	membrane
GO:0048471	0.746	perinuclear region of cytoplasm
GO:0005783	0.727	endoplasmic reticulum
GO:0071944	0.441	cell periphery
GO:0005886	0.392	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]