StarFunc result for job id Q8N6T3

User Input

>input (406 residues)
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVR
SVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAE
GREWSLESSPAQNWTPPQPRTLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQG
NRYVGFGNTPPPQKKEDDFLNNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQKA
SELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQGVGSKGWRDVTTFFSGKAEG
PLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRS
SDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N6T3	0.999	0.999	5.438E-60	406	1.000	1.000	Q8N6T3.pdb.gz	ARFG1_HUMAN ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1 PE=1 SV=2
2	AFDB:Q62848	0.384	0.377	1.092E-49	415	0.865	0.846	Q62848.pdb.gz	ARFG1_RAT ADP-ribosylation factor GTPase-activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arfgap1 PE=1 SV=1
3	AFDB:M9PFF1	0.333	0.304	9.330E-25	448	0.389	0.353	M9PFF1.pdb.gz	M9PFF1_DROME ADP-ribosylation factor GTPase activating protein 1, isoform B OS=Drosophila melanogaster OX=7227 GN=ArfGAP1 PE=1 SV=1
4	AFDB:O18358	0.329	0.287	1.974E-23	468	0.406	0.353	O18358.pdb.gz	O18358_DROME Putative ARF1 GTPase activating protein OS=Drosophila melanogaster OX=7227 GN=ArfGAP1 PE=2 SV=1
5	PDB:3o47A	0.314	0.440	2.704E-21	289	0.315	0.443	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
6	AFDB:Q9M354	0.312	0.280	2.223E-17	459	0.323	0.285	Q9M354.pdb.gz	AGD6_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD6 OS=Arabidopsis thaliana OX=3702 GN=AGD6 PE=1 SV=1
7	AFDB:O80925	0.301	0.269	1.767E-16	456	0.320	0.285	O80925.pdb.gz	AGD7_ARATH ADP-ribosylation factor GTPase-activating protein AGD7 OS=Arabidopsis thaliana OX=3702 GN=AGD7 PE=1 SV=1
8	AFDB:O82171	0.277	0.285	9.406E-12	395	0.195	0.200	O82171.pdb.gz	AGD10_ARATH ADP-ribosylation factor GTPase-activating protein AGD10 OS=Arabidopsis thaliana OX=3702 GN=AGD10 PE=2 SV=1
9	AFDB:Q9FIQ0	0.278	0.281	3.338E-11	402	0.212	0.214	Q9FIQ0.pdb.gz	AGD9_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD9 OS=Arabidopsis thaliana OX=3702 GN=AGD9 PE=1 SV=1
10	AFDB:Q54DK9	0.272	0.212	3.536E-11	522	0.180	0.140	Q54DK9.pdb.gz	Q54DK9_DICDI Arf GTPase activating protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292148 PE=4 SV=1
11	AFDB:Q10367	0.255	0.215	7.057E-11	483	0.229	0.193	Q10367.pdb.gz	GLO3_SCHPO ADP-ribosylation factor GTPase-activating protein glo3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=glo3 PE=3 SV=2
12	PDB:3ljuX	0.204	0.221	1.025E-6	373	0.089	0.097	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:3lvqE	0.204	0.198	7.267E-5	420	0.091	0.088	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
14	PDB:1u5kA	0.107	0.160	1.223	242	0.034	0.058	1u5kA.pdb.gz	A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
15	PDB:2pv0B	0.072	0.083	3.256	347	0.020	0.023	2pv0B.pdb.gz	DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.
16	PDB:7oq4Z	0.075	0.193	7.722	118	0.025	0.085	7oq4Z.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
17	PDB:6dv9F	0.087	0.166	8.180	174	0.047	0.109	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
18	PDB:7rro2	0.055	0.070	8.664	292	0.037	0.051	7rro2.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q62848	0.0	686	415	0.865	0.846	ARFG1_RAT ADP-ribosylation factor GTPase-activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arfgap1 PE=1 SV=1
2	Q8N6T3	0.0	836	406	1.000	1.000	ARFG1_HUMAN ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1 PE=1 SV=2
3	Q9EPJ9	0.0	692	414	0.874	0.857	ARFG1_MOUSE ADP-ribosylation factor GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Arfgap1 PE=1 SV=2
4	Q9VTX5	2.70e-82	261	468	0.355	0.308	Q9VTX5_DROME ADP-ribosylation factor GTPase activating protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ArfGAP1 PE=1 SV=1
5	O18358	2.88e-82	261	468	0.355	0.308	O18358_DROME Putative ARF1 GTPase activating protein OS=Drosophila melanogaster OX=7227 GN=ArfGAP1 PE=2 SV=1
6	M9PFF1	1.43e-75	243	448	0.313	0.283	M9PFF1_DROME ADP-ribosylation factor GTPase activating protein 1, isoform B OS=Drosophila melanogaster OX=7227 GN=ArfGAP1 PE=1 SV=1
7	J9VRH3	1.43e-39	148	420	0.318	0.307	J9VRH3_CRYNH ADP-ribosylation factor GTPase-activating protein 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_05050 PE=4 SV=1
8	O80925	3.23e-39	147	456	0.163	0.145	AGD7_ARATH ADP-ribosylation factor GTPase-activating protein AGD7 OS=Arabidopsis thaliana OX=3702 GN=AGD7 PE=1 SV=1
9	Q9M354	1.29e-38	146	459	0.163	0.144	AGD6_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD6 OS=Arabidopsis thaliana OX=3702 GN=AGD6 PE=1 SV=1
10	A0A1D8PCP6	4.22e-37	140	379	0.246	0.264	A0A1D8PCP6_CANAL Age3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGE3 PE=4 SV=1
11	P35197	1.19e-35	136	352	0.249	0.287	GCS1_YEAST ADP-ribosylation factor GTPase-activating protein GCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCS1 PE=1 SV=1
12	O94601	2.71e-33	129	321	0.214	0.271	YC8E_SCHPO Uncharacterized protein C622.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC622.14 PE=4 SV=2
13	M9PGG0	1.87e-27	115	513	0.158	0.125	M9PGG0_DROME ADP-ribosylation factor GTPase activating protein 3, isoform E OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
14	M9PG88	2.87e-27	115	514	0.145	0.115	M9PG88_DROME ADP-ribosylation factor GTPase activating protein 3, isoform F OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
15	A8JNX0	4.42e-27	115	553	0.145	0.107	A8JNX0_DROME ADP-ribosylation factor GTPase activating protein 3, isoform H OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=2
16	M9PIL3	4.71e-27	115	549	0.145	0.107	M9PIL3_DROME ADP-ribosylation factor GTPase activating protein 3, isoform G OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
17	Q9VNS2	4.75e-27	115	552	0.145	0.107	Q9VNS2_DROME ADP-ribosylation factor GTPase activating protein 3, isoform A OS=Drosophila melanogaster OX=7227 GN=ArfGAP3 PE=1 SV=1
18	Q9NP61	2.24e-26	112	516	0.143	0.112	ARFG3_HUMAN ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3 PE=1 SV=1
19	Q9D8S3	3.59e-26	112	523	0.140	0.109	ARFG3_MOUSE ADP-ribosylation factor GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Arfgap3 PE=1 SV=2
20	Q9FIQ0	4.14e-26	110	402	0.131	0.132	AGD9_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD9 OS=Arabidopsis thaliana OX=3702 GN=AGD9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01412 ArfGap	1.3e-29	114.1	Putative GTPase activating protein for Arf
2	PF01780 Ribosomal_L37ae	4.4e+02	12.4	Ribosomal L37ae protein family
3	PF05715 zf-piccolo	5.4e+02	12.2	Piccolo Zn-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314615

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440005	0.999	ADP-ribosylation factor 1
2	9606.ENSP00000263245	0.994	ADP-ribosylation factor GTPase-activating protein 3
3	9606.ENSP00000434442	0.994	ADP-ribosylation factor GTPase-activating protein 2
4	9606.ENSP00000329471	0.984	ER lumen protein-retaining receptor 1
5	9606.ENSP00000357048	0.970	Coatomer subunit alpha
6	9606.ENSP00000482835	0.965	AP-2 complex subunit beta
7	9606.ENSP00000327694	0.953	AP-2 complex subunit alpha-2
8	9606.ENSP00000263270	0.949	AP-2 complex subunit sigma
9	9606.ENSP00000407586	0.938	GTPase HRas
10	9606.ENSP00000438085	0.938	ADP-ribosylation factor-binding protein GGA3
11	9606.ENSP00000359000	0.937	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
12	9606.ENSP00000258739	0.934	ER lumen protein-retaining receptor 2
13	9606.ENSP00000292807	0.934	AP-2 complex subunit mu
14	9606.ENSP00000479606	0.933	Clathrin heavy chain 1
15	9606.ENSP00000351926	0.932	AP-2 complex subunit alpha-1
16	9606.ENSP00000386918	0.929	ER lumen protein-retaining receptor 3
17	9606.ENSP00000223369	0.927	Synaptobrevin homolog YKT6
18	9606.ENSP00000360798	0.925	Epidermal growth factor receptor substrate 15
19	9606.ENSP00000441158	0.922	Clathrin heavy chain 2
20	9606.ENSP00000000233	0.920	ADP-ribosylation factor 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.980	regulation of biological process
GO:0050794	0.968	regulation of cellular process
GO:0032879	0.922	regulation of localization
GO:0051128	0.915	regulation of cellular component organization
GO:0051049	0.869	regulation of transport
GO:0030100	0.787	regulation of endocytosis
GO:0009987	0.782	cellular process
GO:0051179	0.479	localization
GO:0006810	0.415	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.998	membrane
GO:0012505	0.998	endomembrane system
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005829	0.987	cytosol
GO:0031090	0.970	organelle membrane
GO:0030054	0.968	cell junction
GO:0098588	0.955	bounding membrane of organelle
GO:0005794	0.935	Golgi apparatus
GO:0031982	0.922	vesicle
GO:0000139	0.914	Golgi membrane
GO:0045202	0.904	synapse
GO:0071944	0.375	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]