StarFunc result for job id Q8N6T7

User Input

>input (355 residues)
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPK
EESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A250YGJ5	0.859	0.859	2.539E-68	355	0.913	0.913	A0A250YGJ5.pdb.gz	SIR6_CASCN NAD-dependent protein deacylase sirtuin-6 OS=Castor canadensis OX=51338 GN=SIRT6 PE=1 SV=1
2	AFDB:P59941	0.835	0.887	2.103E-64	334	0.834	0.886	P59941.pdb.gz	SIR6_MOUSE NAD-dependent protein deacylase sirtuin-6 OS=Mus musculus OX=10090 GN=Sirt6 PE=1 SV=1
3	PDB:7cl1A	0.814	0.975	1.699E-58	296	0.834	1.000	7cl1A.pdb.gz	Reply to: Binding site for MDL-801 on SIRT6.
4	AFDB:M0QZ09	0.619	0.796	1.558E-46	275	0.775	1.000	M0QZ09.pdb.gz	M0QZ09_HUMAN Sirtuin 6 (Fragment) OS=Homo sapiens OX=9606 GN=SIRT6 PE=1 SV=8
5	AFDB:Q9VH08	0.762	0.853	1.175E-40	317	0.411	0.461	Q9VH08.pdb.gz	SIR6_DROME NAD-dependent protein deacetylase Sirt6 OS=Drosophila melanogaster OX=7227 GN=Sirt6 PE=1 SV=1
6	AFDB:Q9FE17	0.742	0.559	1.562E-37	473	0.397	0.298	Q9FE17.pdb.gz	SIR1_ARATH NAD-dependent protein deacetylase SRT1 OS=Arabidopsis thaliana OX=3702 GN=SRT1 PE=1 SV=1
7	AFDB:Q95Q89	0.740	0.894	4.440E-32	292	0.301	0.366	Q95Q89.pdb.gz	SIR24_CAEEL NAD-dependent protein deacetylase sir-2.4 OS=Caenorhabditis elegans OX=6239 GN=sir-2.4 PE=3 SV=2
8	AFDB:Q8BKJ9	0.650	0.576	3.963E-27	402	0.321	0.284	Q8BKJ9.pdb.gz	SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus OX=10090 GN=Sirt7 PE=1 SV=2
9	AFDB:A0A2R8QUG9	0.660	0.580	1.262E-26	405	0.301	0.264	A0A2R8QUG9.pdb.gz	A0A2R8QUG9_DANRE NAD-dependent protein deacetylase sirtuin-7 OS=Danio rerio OX=7955 GN=sirt7 PE=4 SV=1
10	AFDB:Q8IKW2	0.707	0.197	2.659E-25	1304	0.296	0.081	Q8IKW2.pdb.gz	SIR2B_PLAF7 NAD-dependent protein deacetylase Sir2B OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=Sir2B PE=1 SV=1
11	AFDB:Q8R216	0.519	0.552	8.656E-19	333	0.211	0.225	Q8R216.pdb.gz	SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus OX=10090 GN=Sirt4 PE=1 SV=3
12	PDB:3u31A	0.490	0.645	4.879E-17	263	0.180	0.243	3u31A.pdb.gz	Plasmodium falciparum Sir2A Preferentially Hydrolyzes Medium and Long Chain Fatty Acyl Lysine
13	PDB:1q14A	0.475	0.576	9.673E-16	289	0.183	0.225	1q14A.pdb.gz	Structure and autoregulation of the Yeast Hst2 homolog of Sir2
14	PDB:6fkyB	0.479	0.623	4.565E-13	266	0.158	0.211	6fkyB.pdb.gz	Potent and Selective Inhibitors of Human Sirtuin 5.
15	PDB:5fyqA	0.478	0.592	7.434E-13	282	0.177	0.223	5fyqA.pdb.gz	Insights Into Lysine-Deacetylation of Natively Folded Substrate Proteins by Sirtuins.
16	PDB:6lpiB	0.278	0.192	8.420E-4	539	0.079	0.052	6lpiB.pdb.gz	Molecular architecture of the acetohydroxyacid synthase holoenzyme.
17	PDB:6deqA	0.299	0.185	3.029E-3	601	0.082	0.048	6deqA.pdb.gz	Commercial AHAS-inhibiting herbicides are promising drug leads for the treatment of human fungal pathogenic infections.
18	PDB:2ihvA	0.317	0.209	4.108E-3	563	0.068	0.043	2ihvA.pdb.gz	Structural and mechanistic studies on N(2)-(2-carboxyethyl)arginine synthase.
19	PDB:3ey9A	0.259	0.168	4.108E-3	571	0.096	0.060	3ey9A.pdb.gz	Structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from Escherichia coli.
20	PDB:2panA	0.293	0.185	4.932E-3	592	0.096	0.057	2panA.pdb.gz	Glyoxylate carboligase lacks the canonical active site glutamate of thiamine-dependent enzymes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A250YGJ5	0.0	640	355	0.913	0.913	SIR6_CASCN NAD-dependent protein deacylase sirtuin-6 OS=Castor canadensis OX=51338 GN=SIRT6 PE=1 SV=1
2	A0A2K5TU92	0.0	707	355	0.980	0.980	SIR6_MACFA NAD-dependent protein deacylase sirtuin-6 OS=Macaca fascicularis OX=9541 GN=SIRT6 PE=1 SV=2
3	A0A8I6APP5	0.0	544	314	0.766	0.866	A0A8I6APP5_RAT Sirtuin 6 OS=Rattus norvegicus OX=10116 GN=Sirt6 PE=4 SV=1
4	P59941	0.0	594	334	0.834	0.886	SIR6_MOUSE NAD-dependent protein deacylase sirtuin-6 OS=Mus musculus OX=10090 GN=Sirt6 PE=1 SV=1
5	Q8N6T7	0.0	724	355	1.000	1.000	SIR6_HUMAN NAD-dependent protein deacylase sirtuin-6 OS=Homo sapiens OX=9606 GN=SIRT6 PE=1 SV=2
6	M0QZ09	8.13e-163	457	275	0.642	0.829	M0QZ09_HUMAN Sirtuin 6 (Fragment) OS=Homo sapiens OX=9606 GN=SIRT6 PE=1 SV=8
7	Q9VH08	8.03e-103	307	317	0.408	0.457	SIR6_DROME NAD-dependent protein deacetylase Sirt6 OS=Drosophila melanogaster OX=7227 GN=Sirt6 PE=1 SV=1
8	Q9FE17	1.36e-93	289	473	0.397	0.298	SIR1_ARATH NAD-dependent protein deacetylase SRT1 OS=Arabidopsis thaliana OX=3702 GN=SRT1 PE=1 SV=1
9	Q95Q89	4.59e-58	191	292	0.293	0.356	SIR24_CAEEL NAD-dependent protein deacetylase sir-2.4 OS=Caenorhabditis elegans OX=6239 GN=sir-2.4 PE=3 SV=2
10	Q8BKJ9	1.45e-53	183	402	0.332	0.294	SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus OX=10090 GN=Sirt7 PE=1 SV=2
11	A0A2R8QUG9	4.82e-53	182	405	0.330	0.289	A0A2R8QUG9_DANRE NAD-dependent protein deacetylase sirtuin-7 OS=Danio rerio OX=7955 GN=sirt7 PE=4 SV=1
12	Q9NRC8	2.36e-52	180	400	0.332	0.295	SIR7_HUMAN NAD-dependent protein deacetylase sirtuin-7 OS=Homo sapiens OX=9606 GN=SIRT7 PE=1 SV=1
13	Q94AQ6	3.02e-24	104	373	0.239	0.228	SIR4_ARATH NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana OX=3702 GN=SRT2 PE=1 SV=1
14	Q8IKW2	6.58e-23	102	1304	0.158	0.043	SIR2B_PLAF7 NAD-dependent protein deacetylase Sir2B OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=Sir2B PE=1 SV=1
15	Q9USN7	3.84e-21	94.7	332	0.203	0.217	HST2_SCHPO NAD-dependent protein deacetylase hst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hst2 PE=3 SV=1
16	Q1JQC6	5.33e-21	94.0	315	0.242	0.273	SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus OX=9913 GN=SIRT4 PE=2 SV=1
17	G3V641	1.02e-20	93.2	311	0.225	0.257	G3V641_RAT NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sirt4 PE=3 SV=1
18	Q8R216	1.23e-20	93.6	333	0.225	0.240	SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus OX=10090 GN=Sirt4 PE=1 SV=3
19	A0A0G2K6D8	1.56e-20	92.8	319	0.225	0.251	A0A0G2K6D8_RAT NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sirt4 PE=3 SV=1
20	P66815	1.45e-19	88.6	243	0.194	0.284	NPD_STAAM NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=cobB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02146 SIR2	1.4e-21	88.8	Sir2 family
2	PF00205 TPP_enzyme_M	2.4	19.3	Thiamine pyrophosphate enzyme, central domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337332

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384273	0.994	Transcription factor p65
2	9606.ENSP00000437955	0.989	Hypoxia-inducible factor 1-alpha
3	9606.ENSP00000222553	0.981	Nicotinamide phosphoribosyltransferase
4	9606.ENSP00000283131	0.978	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
5	9606.ENSP00000382628	0.950	DNA endonuclease RBBP8
6	9606.ENSP00000441434	0.940	Nicotinamide N-methyltransferase
7	9606.ENSP00000479618	0.929	Myc proto-oncogene protein
8	9606.ENSP00000264663	0.925	NAD(P) transhydrogenase, mitochondrial
9	9606.ENSP00000326424	0.924	Glutamine-dependent NAD(+) synthetase
10	9606.ENSP00000354532	0.919	Purine nucleoside phosphorylase
11	9606.ENSP00000230792	0.912	Peroxisomal NADH pyrophosphatase NUDT12
12	9606.ENSP00000371362	0.912	NAD kinase 2, mitochondrial
13	9606.ENSP00000355759	0.898	Poly [ADP-ribose] polymerase 1
14	9606.ENSP00000385824	0.876	Forkhead box protein O3
15	9606.ENSP00000366410	0.862	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
16	9606.ENSP00000376611	0.861	G/T mismatch-specific thymine DNA glycosylase
17	9606.ENSP00000358151	0.850	Histone H2B type 2-E
18	9606.ENSP00000295757	0.849	Histone deacetylase 11
19	9606.ENSP00000362649	0.845	Histone deacetylase 1
20	9606.ENSP00000340523	0.843	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017136	0.999	NAD-dependent histone deacetylase activity
GO:0005515	0.995	protein binding
GO:0097159	0.868	organic cyclic compound binding
GO:1901363	0.840	heterocyclic compound binding
GO:0016740	0.808	transferase activity
GO:0032129	0.690	histone H3K9 deacetylase activity
GO:0046969	0.658	NAD-dependent histone H3K9 deacetylase activity
GO:0034739	0.637	histone H4K16 deacetylase activity
GO:0003676	0.602	nucleic acid binding
GO:0003677	0.523	DNA binding
GO:0140765	0.472	NAD-dependent histone H3K56 deacetylase activity
GO:0097372	0.437	NAD-dependent histone H3K18 deacetylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.989	cellular process
GO:0019222	0.988	regulation of metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0048519	0.977	negative regulation of biological process
GO:0031323	0.947	regulation of cellular metabolic process
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0019219	0.936	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.935	response to stimulus
GO:0032501	0.900	multicellular organismal process
GO:0048518	0.899	positive regulation of biological process
GO:0009893	0.880	positive regulation of metabolic process
GO:0048523	0.867	negative regulation of cellular process
GO:0010468	0.846	regulation of gene expression
GO:0010604	0.836	positive regulation of macromolecule metabolic process
GO:0008152	0.827	metabolic process
GO:0071704	0.813	organic substance metabolic process
GO:0031326	0.785	regulation of cellular biosynthetic process
GO:0048522	0.773	positive regulation of cellular process
GO:0051716	0.771	cellular response to stimulus
GO:0044238	0.770	primary metabolic process
GO:0009892	0.769	negative regulation of metabolic process
GO:0006807	0.752	nitrogen compound metabolic process
GO:0031324	0.674	negative regulation of cellular metabolic process
GO:0051172	0.664	negative regulation of nitrogen compound metabolic process
GO:0010605	0.648	negative regulation of macromolecule metabolic process
GO:0045934	0.634	negative regulation of nucleobase-containing compound metabolic process
GO:0048583	0.601	regulation of response to stimulus
GO:0044237	0.600	cellular metabolic process
GO:0009890	0.582	negative regulation of biosynthetic process
GO:0010556	0.567	regulation of macromolecule biosynthetic process
GO:0031327	0.552	negative regulation of cellular biosynthetic process
GO:0006950	0.538	response to stress
GO:0031325	0.515	positive regulation of cellular metabolic process
GO:0033554	0.510	cellular response to stress
GO:0051173	0.510	positive regulation of nitrogen compound metabolic process
GO:0043170	0.504	macromolecule metabolic process
GO:0045935	0.489	positive regulation of nucleobase-containing compound metabolic process
GO:0051252	0.461	regulation of RNA metabolic process
GO:0006355	0.442	regulation of DNA-templated transcription
GO:0080134	0.409	regulation of response to stress
GO:0071840	0.388	cellular component organization or biogenesis
GO:0006357	0.388	regulation of transcription by RNA polymerase II
GO:1901564	0.375	organonitrogen compound metabolic process
GO:0032502	0.346	developmental process
GO:0034641	0.346	cellular nitrogen compound metabolic process
GO:0016043	0.332	cellular component organization
GO:0048584	0.331	positive regulation of response to stimulus
GO:0046483	0.323	heterocycle metabolic process
GO:1901360	0.315	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.990	cytoplasm
GO:0043232	0.968	intracellular non-membrane-bounded organelle
GO:0005694	0.784	chromosome
GO:0012505	0.750	endomembrane system
GO:0000785	0.566	chromatin
GO:0098687	0.363	chromosomal region
GO:0000781	0.349	chromosome, telomeric region
GO:0032991	0.323	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	0.999	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	0.999	histone deacetylase.
EC:2.-.-.-	0.808	Transferases.

[back to server]