StarFunc result for job id Q8N6Y2

User Input

>input (441 residues)
MRVVTIVILLCFCKAAELRKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYL
HEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKI
ESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQI
PRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDST
FCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELKKLNLS
SNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDNPWRCDYNIHY
LYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDE
WEKKHRDHTAKKQSVIITIVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CXD9	0.389	0.387	3.355E-66	443	0.878	0.874	Q9CXD9.pdb.gz	LRC17_MOUSE Leucine-rich repeat-containing protein 17 OS=Mus musculus OX=10090 GN=Lrrc17 PE=2 SV=1
2	AFDB:B8A498	0.294	0.096	3.319E-22	1524	0.229	0.066	B8A498.pdb.gz
3	AFDB:A0A2R8QDY6	0.271	0.094	5.585E-22	1532	0.236	0.068	A0A2R8QDY6.pdb.gz
4	AFDB:F1RCV3	0.260	0.092	1.157E-21	1516	0.224	0.065	F1RCV3.pdb.gz	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
5	AFDB:O75093	0.253	0.091	2.051E-21	1534	0.220	0.063	O75093.pdb.gz	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
6	AFDB:P24014	0.306	0.098	2.051E-21	1504	0.243	0.071	P24014.pdb.gz	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
7	AFDB:O94813	0.258	0.089	2.952E-21	1529	0.227	0.065	O94813.pdb.gz	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
8	AFDB:O75094	0.265	0.090	3.109E-21	1523	0.236	0.068	O75094.pdb.gz	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
9	AFDB:A0A2R8RXU4	0.270	0.094	1.203E-20	1521	0.218	0.063	A0A2R8RXU4.pdb.gz
10	AFDB:D3Z8D8	0.286	0.192	1.127E-19	696	0.240	0.152	D3Z8D8.pdb.gz	D3Z8D8_RAT SLIT and NTRK-like family, member 1 OS=Rattus norvegicus OX=10116 GN=Slitrk1 PE=4 SV=1
11	PDB:1xcdA	0.244	0.346	1.877E-10	305	0.154	0.223	1xcdA.pdb.gz
12	PDB:2ft3F	0.281	0.387	6.213E-10	305	0.152	0.220	2ft3F.pdb.gz
13	PDB:3t6qA	0.313	0.240	2.403E-9	601	0.129	0.095	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:5yq5B	0.289	0.386	2.532E-9	306	0.145	0.209	5yq5B.pdb.gz
15	PDB:7tvfD	0.283	0.249	2.667E-9	515	0.141	0.120	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
16	PDB:7wv3A	0.346	0.244	6.131E-9	668	0.156	0.103	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
17	PDB:5y31B	0.269	0.235	2.632E-8	511	0.091	0.078	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
18	PDB:6gffI	0.224	0.182	3.414E-8	551	0.141	0.113	6gffI.pdb.gz
19	PDB:3b2dA	0.302	0.235	3.596E-8	601	0.141	0.103	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
20	PDB:6hkwA	0.287	0.390	1.190E-7	306	0.132	0.190	6hkwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9CXD9	0.0	784	443	0.875	0.871	LRC17_MOUSE Leucine-rich repeat-containing protein 17 OS=Mus musculus OX=10090 GN=Lrrc17 PE=2 SV=1
2	Q9WVC1	4.07e-27	116	766	0.224	0.129	SLIT2_RAT Slit homolog 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Slit2 PE=1 SV=3
3	Q9R1B9	1.16e-26	115	1521	0.222	0.064	SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus OX=10090 GN=Slit2 PE=2 SV=2
4	O75094	1.21e-26	115	1523	0.220	0.064	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
5	Q3Y6S4	1.26e-26	115	1532	0.220	0.063	Q3Y6S4_DANRE Slit homolog 1b precursor OS=Danio rerio OX=7955 GN=slit1b PE=2 SV=1
6	O75093	1.75e-26	115	1534	0.227	0.065	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
7	P24014	1.86e-26	115	1504	0.222	0.065	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
8	A0A0R4IU60	3.15e-26	114	1531	0.220	0.063	A0A0R4IU60_DANRE Slit homolog 1b (Drosophila) OS=Danio rerio OX=7955 GN=slit1b PE=4 SV=1
9	D2XV92	3.47e-26	114	1513	0.220	0.064	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
10	Q9WVB4	6.09e-26	113	1523	0.218	0.063	SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus OX=10090 GN=Slit3 PE=2 SV=2
11	Q80TR4	7.39e-26	113	1531	0.234	0.067	SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2
12	O88279	9.64e-26	113	1531	0.213	0.061	SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1
13	O94813	1.70e-25	112	1529	0.218	0.063	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
14	Q3S2J2	2.83e-25	111	1524	0.211	0.061	Q3S2J2_DANRE Slit homolog 1 protein precursor OS=Danio rerio OX=7955 GN=slit1a PE=1 SV=1
15	O88280	4.16e-25	111	1523	0.218	0.063	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
16	Q9DE36	6.04e-25	110	1512	0.211	0.062	Q9DE36_DANRE Slit homolog 2 protein precursor OS=Danio rerio OX=7955 GN=slit2 PE=1 SV=1
17	F1RCV3	1.36e-24	109	1516	0.213	0.062	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
18	Q90Z44	1.80e-24	108	950	0.186	0.086	Q90Z44_CHICK Slit2 protein (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
19	Q90XG2	3.01e-24	108	783	0.186	0.105	Q90XG2_CHICK Slit-2 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
20	Q90Z45	1.71e-23	105	738	0.188	0.112	Q90Z45_CHICK Slit1 protein (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	0.03	25.6	Leucine Rich Repeat
2	PF12799 LRR_4	1.2e-10	52.7	Leucine Rich repeats (2 copies)
3	PF13306 LRR_5	1.9e-08	45.7	BspA type Leucine rich repeat region (6 copies)
4	PF13516 LRR_6	0.037	25.1	Leucine Rich repeat
5	PF13855 LRR_8	3.5e-27	105.3	Leucine rich repeat
6	PF14580 LRR_9	0.00029	31.9	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344242

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347586	0.740	Coiled-coil domain-containing protein 69
2	9606.ENSP00000448955	0.736	GAS2-like protein 3
3	9606.ENSP00000418668	0.687	Caveolae-associated protein 4
4	9606.ENSP00000337439	0.672	Dapper homolog 1
5	9606.ENSP00000255416	0.671	Myosin-binding protein H
6	9606.ENSP00000367638	0.656	Rho guanine nucleotide exchange factor 39
7	9606.ENSP00000415332	0.648	SEC14 domain and spectrin repeat-containing protein 1
8	9606.ENSP00000481103	0.633	Transcription factor E2F8
9	9606.ENSP00000479266	0.627	Protein aurora borealis
10	9606.ENSP00000206595	0.626	G2/M phase-specific E3 ubiquitin-protein ligase
11	9606.ENSP00000264228	0.623	Polyprenol reductase
12	9606.ENSP00000305204	0.620	Cytoskeleton-associated protein 2-like
13	9606.ENSP00000361636	0.619	Troponin C, skeletal muscle
14	9606.ENSP00000370419	0.605	Tetratricopeptide repeat domain containing
15	9606.ENSP00000250535	0.597	Cysteine dioxygenase type 1
16	9606.ENSP00000430241	0.597	Transcription factor COE2
17	9606.ENSP00000306788	0.594	ADP-ribosylation factor-like protein 6-interacting protein 1
18	9606.ENSP00000216513	0.571	Homeobox protein SIX4
19	9606.ENSP00000321927	0.571	F-box/LRR-repeat protein 13
20	9606.ENSP00000434515	0.563	Solute carrier family 43 member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0032502	0.968	developmental process
GO:0032501	0.927	multicellular organismal process
GO:0048856	0.924	anatomical structure development
GO:0007275	0.860	multicellular organism development
GO:0048519	0.857	negative regulation of biological process
GO:0048731	0.813	system development
GO:0009987	0.730	cellular process
GO:0048523	0.699	negative regulation of cellular process
GO:0051239	0.566	regulation of multicellular organismal process
GO:0002682	0.481	regulation of immune system process
GO:0045637	0.466	regulation of myeloid cell differentiation
GO:0002761	0.461	regulation of myeloid leukocyte differentiation
GO:0002520	0.453	immune system development
GO:0048534	0.437	hematopoietic or lymphoid organ development
GO:0051093	0.396	negative regulation of developmental process
GO:0045670	0.379	regulation of osteoclast differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0043226	0.927	organelle
GO:0016020	0.911	membrane
GO:0005576	0.855	extracellular region
GO:0005622	0.849	intracellular anatomical structure
GO:0071944	0.818	cell periphery
GO:0043229	0.779	intracellular organelle
GO:0005886	0.775	plasma membrane
GO:0043227	0.668	membrane-bounded organelle
GO:0005634	0.654	nucleus
GO:0005615	0.647	extracellular space
GO:0031974	0.366	membrane-enclosed lumen
GO:0043233	0.355	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]