StarFunc result for job id Q8N720

User Input

>input (491 residues)
MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGDGETREENKLLIPKQ
KISEEVHSYKVRVGRLKHDITQVPETREVYKSEDRLERLQEILRKFLYLEREFRQITISK
ETFTSEKNNECHEPEKSFSLDSTIDADQRVLRIQNTDDNDKYDMSFNQNSASGKHEHLNL
TEDFQSSECKESLMDLSHLNKWESIPNTEKSYKCDVCGKIFHQSSALTRHQRIHTREKPY
KCKECEKSFSQSSSLSRHKRIHTREKPYKCEASDKSCEASDKSCSPSSGIIQHKKIHTRA
KSYKCSSCERVFSRSVHLTQHQKIHKEMPCKCTVCGSDFCHTSYLLEHQRVHHEEKAYEY
DEYGLAYIKQQGIHFREKPYTCSECGKDFRLNSHLIQHQRIHTGEKAHECNECGKAFSQT
SCLIQHHKMHRKEKSYECNEYEGSFSHSSDLILQQEVLTRQKAFDCDVWEKNSSQRAHLV
QHQSIHTKENS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N720	1.000	1.000	2.323E-77	491	1.000	1.000	Q8N720.pdb.gz	ZN655_HUMAN Zinc finger protein 655 OS=Homo sapiens OX=9606 GN=ZNF655 PE=1 SV=3
2	AFDB:A6NHJ4	0.235	0.195	1.033E-25	632	0.308	0.239	A6NHJ4.pdb.gz	ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens OX=9606 GN=ZNF860 PE=1 SV=3
3	AFDB:P51814	0.210	0.137	7.518E-25	821	0.303	0.181	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
4	AFDB:Q9P2J8	0.195	0.116	7.518E-25	865	0.344	0.195	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
5	AFDB:Q15776	0.324	0.279	2.208E-24	578	0.314	0.266	Q15776.pdb.gz	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
6	AFDB:Q5MCW4	0.235	0.177	3.893E-24	686	0.344	0.246	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
7	AFDB:Q9C0F3	0.222	0.230	6.486E-24	470	0.301	0.315	Q9C0F3.pdb.gz	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
8	AFDB:P17020	0.204	0.151	1.021E-23	682	0.367	0.264	P17020.pdb.gz	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
9	AFDB:Q8NF99	0.317	0.295	1.435E-23	534	0.316	0.290	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
10	AFDB:Q7L2R6	0.247	0.235	1.800E-23	523	0.293	0.275	Q7L2R6.pdb.gz	ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens OX=9606 GN=ZNF765 PE=1 SV=2
11	PDB:3w5kB	0.092	0.247	5.354E-3	110	0.077	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5n9jV	0.138	0.560	1.311	99	0.020	0.101	5n9jV.pdb.gz
13	PDB:7uhyA	0.055	0.038	1.555	771	0.045	0.029	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:1tjlA	0.121	0.369	2.064	145	0.018	0.062	1tjlA.pdb.gz	Regulation through the secondary channel--structural framework for ppGpp-DksA synergism during transcription
15	PDB:3aaiA	0.089	0.394	2.590	78	0.026	0.167	3aaiA.pdb.gz
16	PDB:3mxzA	0.117	0.402	2.590	107	0.024	0.112	3mxzA.pdb.gz
17	PDB:6gejS	0.061	0.113	2.590	208	0.081	0.192	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
18	PDB:6wczA	0.072	0.099	2.590	350	0.012	0.017	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
19	PDB:7ns4b	0.095	0.126	2.590	340	0.077	0.112	7ns4b.pdb.gz	GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
20	PDB:7ad8D	0.045	0.065	3.249	280	0.043	0.075	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N720	0.0	1011	491	1.000	1.000	ZN655_HUMAN Zinc finger protein 655 OS=Homo sapiens OX=9606 GN=ZNF655 PE=1 SV=3
2	Q9BRH9	3.15e-87	283	671	0.356	0.261	ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens OX=9606 GN=ZNF251 PE=1 SV=4
3	Q96NJ6	1.53e-86	276	502	0.371	0.363	ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens OX=9606 GN=ZFP3 PE=1 SV=1
4	Q8BLA2	6.59e-86	277	578	0.332	0.282	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
5	Q7TMN8	6.81e-86	277	578	0.332	0.282	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
6	Q9P0L1	6.93e-85	279	754	0.348	0.227	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
7	Q6ZN57	8.81e-85	270	461	0.326	0.347	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
8	Q8TAQ5	5.29e-84	275	688	0.332	0.237	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
9	P17020	1.45e-83	273	682	0.332	0.239	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
10	Q9BX82	1.96e-82	269	626	0.387	0.304	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
11	Q8BLE1	3.34e-81	257	338	0.293	0.426	Q8BLE1_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
12	Q15937	6.66e-81	261	498	0.301	0.297	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
13	Q14585	2.66e-80	259	488	0.324	0.326	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
14	Q9UC06	2.85e-80	258	446	0.342	0.377	ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens OX=9606 GN=ZNF70 PE=2 SV=2
15	P15620	5.76e-80	261	580	0.326	0.276	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
16	Q09FC8	1.98e-79	261	603	0.318	0.259	ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens OX=9606 GN=ZNF415 PE=1 SV=2
17	P52742	3.00e-79	261	658	0.338	0.252	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
18	P35789	3.34e-79	260	620	0.320	0.253	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
19	P17027	3.41e-79	261	643	0.332	0.253	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
20	Q8TBZ5	6.03e-79	258	544	0.310	0.279	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	1.1e-21	87.1	Zinc finger, C2H2 type
2	PF16622 zf-C2H2_11	34	15.6	zinc-finger C2H2-type
3	PF13894 zf-C2H2_4	1.4e-08	45.9	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	0.0065	27.7	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	0.82	21.3	Zinc-finger double-stranded RNA-binding
6	PF13465 zf-H2C2_2	1.4e-29	112.4	Zinc-finger double domain
7	PF09723 Zn-ribbon_8	0.52	21.8	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393876

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479860	0.688	Calcium and integrin binding 1
2	9606.ENSP00000261191	0.682	Integrator complex subunit 13
3	9606.ENSP00000379643	0.648	Nuclear distribution protein nudE homolog 1
4	9606.ENSP00000223210	0.618	Zinc finger protein 862
5	9606.ENSP00000317445	0.596	Proactivator polypeptide-like 1
6	9606.ENSP00000472929	0.581	Proto-oncogene vav
7	9606.ENSP00000354543	0.521	TSC22 domain family member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.686	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048519	0.845	negative regulation of biological process
GO:0010564	0.806	regulation of cell cycle process
GO:0048523	0.797	negative regulation of cellular process
GO:0009987	0.796	cellular process
GO:0007346	0.743	regulation of mitotic cell cycle
GO:0051171	0.730	regulation of nitrogen compound metabolic process
GO:0060255	0.720	regulation of macromolecule metabolic process
GO:1901987	0.700	regulation of cell cycle phase transition
GO:0080090	0.680	regulation of primary metabolic process
GO:1902806	0.581	regulation of cell cycle G1/S phase transition
GO:1901988	0.502	negative regulation of cell cycle phase transition
GO:0031323	0.479	regulation of cellular metabolic process
GO:1901990	0.475	regulation of mitotic cell cycle phase transition
GO:1902807	0.432	negative regulation of cell cycle G1/S phase transition
GO:0010468	0.414	regulation of gene expression
GO:2000045	0.403	regulation of G1/S transition of mitotic cell cycle
GO:0045930	0.386	negative regulation of mitotic cell cycle
GO:0009889	0.329	regulation of biosynthetic process
GO:0019219	0.327	regulation of nucleobase-containing compound metabolic process
GO:2000134	0.327	negative regulation of G1/S transition of mitotic cell cycle
GO:0051252	0.317	regulation of RNA metabolic process
GO:0010556	0.310	regulation of macromolecule biosynthetic process
GO:0031326	0.310	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.996	nuclear lumen
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005737	0.959	cytoplasm
GO:0005654	0.898	nucleoplasm
GO:0005730	0.523	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]