StarFunc result for job id Q8N743

User Input

>input (410 residues)
MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSL
SKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGV
HRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNY
SMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRAL
PHAWSDPSDPLPVSVTGNSRHLHVLIGTSVVIIPFAILLFFLLHRWCANKKNAVVMDQEP
AGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQRPKTPPTDTSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N743	1.000	1.000	4.614E-78	410	1.000	1.000	Q8N743.pdb.gz	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
2	AFDB:P43630	0.689	0.623	7.047E-59	455	0.766	0.690	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
3	AFDB:P43629	0.668	0.619	2.528E-58	444	0.763	0.705	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
4	AFDB:P43626	0.473	0.557	1.035E-40	348	0.561	0.661	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
5	AFDB:Q99706	0.243	0.264	1.713E-38	377	0.549	0.597	Q99706.pdb.gz	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
6	AFDB:P43632	0.480	0.645	3.806E-38	304	0.498	0.671	P43632.pdb.gz	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
7	AFDB:Q14952	0.471	0.632	1.046E-37	304	0.476	0.641	Q14952.pdb.gz	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
8	AFDB:O75022	0.577	0.392	7.686E-35	631	0.405	0.263	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
9	AFDB:Q8N423	0.552	0.395	7.686E-35	598	0.380	0.261	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
10	AFDB:Q8NHL6	0.571	0.380	2.908E-34	650	0.376	0.237	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
11	PDB:5oj2B	0.178	0.119	2.059E-8	692	0.110	0.065	5oj2B.pdb.gz
12	PDB:5mj3A	0.242	0.304	3.845E-7	302	0.098	0.132	5mj3A.pdb.gz
13	PDB:6pxvA	0.167	0.095	1.057E-6	823	0.102	0.051	6pxvA.pdb.gz
14	PDB:6dldD	0.182	0.257	1.379E-6	269	0.117	0.178	6dldD.pdb.gz
15	PDB:7q5zA	0.187	0.072	2.002E-6	1344	0.093	0.028	7q5zA.pdb.gz
16	PDB:5c6wJ	0.218	0.338	3.594E-6	238	0.063	0.109	5c6wJ.pdb.gz
17	PDB:1e07A	0.195	0.140	3.998E-6	642	0.117	0.075	1e07A.pdb.gz
18	PDB:1ngwH	0.220	0.338	4.947E-6	216	0.080	0.153	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
19	PDB:1hzhH	0.204	0.187	7.572E-6	457	0.124	0.112	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
20	PDB:7q1yA	0.161	0.063	7.986E-6	1374	0.110	0.033	7q1yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43629	0.0	612	444	0.763	0.705	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
2	P43630	0.0	626	455	0.785	0.708	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
3	Q14943	0.0	521	382	0.637	0.683	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
4	Q8N743	0.0	845	410	1.000	1.000	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
5	P43628	1.79e-159	454	341	0.576	0.692	KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 OS=Homo sapiens OX=9606 GN=KIR2DL3 PE=1 SV=1
6	P43627	6.63e-154	440	348	0.561	0.661	KI2L2_HUMAN Killer cell immunoglobulin-like receptor 2DL2 OS=Homo sapiens OX=9606 GN=KIR2DL2 PE=1 SV=1
7	P43626	1.52e-153	439	348	0.561	0.661	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
8	P43631	1.64e-146	420	304	0.507	0.684	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
9	Q14954	7.86e-145	416	304	0.505	0.681	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
10	P43632	2.35e-143	412	304	0.498	0.671	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
11	Q14953	2.81e-138	399	304	0.495	0.668	KI2S5_HUMAN Killer cell immunoglobulin-like receptor 2DS5 OS=Homo sapiens OX=9606 GN=KIR2DS5 PE=1 SV=2
12	Q14952	1.34e-132	384	304	0.476	0.641	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
13	Q99706	8.88e-118	349	377	0.456	0.496	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
14	F2VZG2	9.29e-118	346	293	0.439	0.614	F2VZG2_PANTR KIR2DS4 OS=Pan troglodytes OX=9598 GN=KIR2DS4 PE=1 SV=1
15	O75022	1.67e-73	243	631	0.359	0.233	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
16	Q8NHL6	2.38e-66	224	650	0.324	0.205	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
17	O75019	3.37e-66	220	489	0.327	0.274	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
18	Q8N423	4.94e-65	220	597	0.407	0.280	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
19	P59901	1.18e-64	216	499	0.317	0.261	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
20	Q8N149	4.70e-64	214	483	0.329	0.280	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	1.8e-23	93.8	Immunoglobulin domain
2	PF13895 Ig_2	1.3e-09	49.6	Immunoglobulin domain
3	PF13927 Ig_3	6.3e-10	50.8	Immunoglobulin domain
4	PF07686 V-set	0.026	26.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291860

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365402	0.967	HLA class I histocompatibility antigen, Cw-7 alpha chain
2	9606.ENSP00000379873	0.955	HLA class I histocompatibility antigen, A-3 alpha chain
3	9606.ENSP00000438038	0.947	NKG2-A/NKG2-B type II integral membrane protein
4	9606.ENSP00000371333	0.946	Natural killer cells antigen CD94
5	9606.ENSP00000399168	0.936	HLA class I histocompatibility antigen, B-7 alpha chain
6	9606.ENSP00000371327	0.932	NKG2-C type II integral membrane protein
7	9606.ENSP00000412927	0.903	HLA class I histocompatibility antigen, alpha chain G
8	9606.ENSP00000365817	0.851	HLA class I histocompatibility antigen, alpha chain E
9	9606.ENSP00000340944	0.845	Tyrosine-protein phosphatase non-receptor type 11
10	9606.ENSP00000310216	0.824	NKG2-F type II integral membrane protein
11	9606.ENSP00000391592	0.822	Tyrosine-protein phosphatase non-receptor type 6
12	9606.ENSP00000437563	0.811	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells
13	9606.ENSP00000336769	0.810	Killer cell immunoglobulin-like receptor 2DL1
14	9606.ENSP00000325525	0.809	Killer cell immunoglobulin-like receptor 3DL2
15	9606.ENSP00000342215	0.809	Killer cell immunoglobulin-like receptor 2DL3
16	9606.ENSP00000375608	0.808	Killer cell immunoglobulin-like receptor 3DL1
17	9606.ENSP00000480609	0.738	annotation not available
18	9606.ENSP00000273183	0.735	SH3 and cysteine-rich domain-containing protein
19	9606.ENSP00000326432	0.727	C-C chemokine receptor type 8
20	9606.ENSP00000259951	0.711	HLA class I histocompatibility antigen, alpha chain F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.911	signaling receptor activity
GO:0004888	0.506	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0007165	0.923	signal transduction
GO:0006950	0.915	response to stress
GO:0002376	0.899	immune system process
GO:0006952	0.894	defense response
GO:0048583	0.743	regulation of response to stimulus
GO:0002682	0.723	regulation of immune system process
GO:0007166	0.716	cell surface receptor signaling pathway
GO:0048518	0.659	positive regulation of biological process
GO:0050776	0.549	regulation of immune response
GO:0006955	0.524	immune response
GO:0048519	0.456	negative regulation of biological process
GO:0048523	0.453	negative regulation of cellular process
GO:0032501	0.441	multicellular organismal process
GO:0048522	0.432	positive regulation of cellular process
GO:0002768	0.432	immune response-regulating cell surface receptor signaling pathway
GO:0002684	0.423	positive regulation of immune system process
GO:0002831	0.406	regulation of response to biotic stimulus
GO:0006968	0.391	cellular defense response
GO:0045088	0.379	regulation of innate immune response
GO:0048584	0.367	positive regulation of response to stimulus
GO:0050778	0.363	positive regulation of immune response
GO:0002443	0.332	leukocyte mediated immunity
GO:0051239	0.328	regulation of multicellular organismal process
GO:0002449	0.321	lymphocyte mediated immunity
GO:0009605	0.308	response to external stimulus
GO:0009607	0.307	response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043231	0.739	intracellular membrane-bounded organelle
GO:0005737	0.444	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]