StarFunc result for job id Q8N766

User Input

>input (993 residues)
MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASLEFSPGSKKLVVATEK
NVIAALNSRTGEILWRHVDKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLNWE
ITLDSGSFQALGLVGLQESVRYIAVLKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYS
YGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDP
SSRSLQTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFFLHLSPSHY
ALLQYHYGTLSLLKNFPQTALVSFATTGEKTVAAVMACRNEVQKSSSSEDGSMGSFSEKS
SSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYR
ALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGL
LGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVT
ASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKESGMSS
LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLR
QLHELAPSIFFYLVDAEQGRLCGYRLRKDLTTELSWELTIPPEVQRIVKVKGKRSSEHVH
SQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHERTFIGIFLIDGVTGRIIHSSVQKKAKG
PVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFSSLDRPQLPQVLQQSYIF
PSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSP
DVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDY
DYVLISSVLFGLVFATMITKRLAQVKLLNRAWR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C7X2	0.962	0.959	0.000	997	0.932	0.928	Q8C7X2.pdb.gz	EMC1_MOUSE ER membrane protein complex subunit 1 OS=Mus musculus OX=10090 GN=Emc1 PE=1 SV=1
2	AFDB:Q9VHY6	0.758	0.818	3.941E-76	915	0.334	0.363	Q9VHY6.pdb.gz	Q9VHY6_DROME ER membrane protein complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=EMC1 PE=1 SV=1
3	AFDB:F4JXW9	0.796	0.804	2.489E-73	982	0.285	0.288	F4JXW9.pdb.gz	F4JXW9_ARATH ER membrane protein complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=At5g11560 PE=1 SV=1
4	AFDB:O13981	0.709	0.786	7.285E-51	885	0.192	0.216	O13981.pdb.gz	EMC1_SCHPO ER membrane protein complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=emc1 PE=3 SV=1
5	AFDB:P25574	0.531	0.677	3.285E-38	760	0.161	0.211	P25574.pdb.gz	EMC1_YEAST ER membrane protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EMC1 PE=1 SV=1
6	AFDB:Q99973	0.150	0.071	1.565E-16	2627	0.111	0.042	Q99973.pdb.gz	TEP1_HUMAN Telomerase protein component 1 OS=Homo sapiens OX=9606 GN=TEP1 PE=1 SV=2
7	AFDB:Q5XFW6	0.245	0.222	2.647E-16	1125	0.111	0.098	Q5XFW6.pdb.gz	WDR6_RAT tRNA (34-2'-O)-methyltransferase regulator WDR6 OS=Rattus norvegicus OX=10116 GN=Wdr6 PE=1 SV=2
8	AFDB:P97499	0.227	0.097	3.055E-16	2629	0.105	0.040	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
9	PDB:6jp6A	0.224	0.224	1.616E-15	998	0.100	0.099	6jp6A.pdb.gz
10	AFDB:Q08924	0.213	0.209	2.499E-15	1013	0.106	0.104	Q08924.pdb.gz	WDR6_YEAST tRNA (34-2'-O)-methyltransferase regulator RTT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTT10 PE=1 SV=1
11	PDB:7mq8LR	0.327	0.399	2.605E-15	773	0.089	0.114	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	AFDB:O08653	0.157	0.090	2.884E-15	2629	0.099	0.037	O08653.pdb.gz	TEP1_RAT Telomerase protein component 1 OS=Rattus norvegicus OX=10116 GN=Tep1 PE=1 SV=1
13	PDB:7d5sBE	0.279	0.307	4.004E-15	865	0.099	0.113	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
14	PDB:7mq8LT	0.290	0.320	2.131E-14	869	0.087	0.099	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6lqsBE	0.284	0.325	4.159E-14	823	0.100	0.120	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
16	PDB:5hxbY	0.216	0.201	5.281E-14	1080	0.103	0.094	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
17	PDB:6xk9Y	0.214	0.195	6.392E-14	1106	0.101	0.090	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.
18	PDB:7ajuUL	0.316	0.379	8.117E-14	779	0.092	0.117	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:5wyjBE	0.287	0.348	1.248E-13	753	0.099	0.130	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
20	PDB:3e0cA	0.171	0.168	2.321E-13	1011	0.096	0.094	3e0cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C7X2	0.0	1900	997	0.931	0.927	EMC1_MOUSE ER membrane protein complex subunit 1 OS=Mus musculus OX=10090 GN=Emc1 PE=1 SV=1
2	Q8N766	0.0	2048	993	1.000	1.000	EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens OX=9606 GN=EMC1 PE=1 SV=1
3	A0A0B4LGV1	1.48e-150	471	908	0.254	0.278	A0A0B4LGV1_DROME ER membrane protein complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=EMC1 PE=1 SV=1
4	Q9VHY6	5.69e-148	465	915	0.255	0.277	Q9VHY6_DROME ER membrane protein complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=EMC1 PE=1 SV=1
5	Q95TQ6	1.05e-142	438	521	0.236	0.449	Q95TQ6_DROME ER membrane protein complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=EMC1 PE=2 SV=1
6	F4JXW9	1.81e-106	356	982	0.298	0.301	F4JXW9_ARATH ER membrane protein complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=At5g11560 PE=1 SV=1
7	O13981	2.38e-46	182	885	0.152	0.171	EMC1_SCHPO ER membrane protein complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=emc1 PE=3 SV=1
8	P25574	1.63e-29	128	760	0.097	0.126	EMC1_YEAST ER membrane protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EMC1 PE=1 SV=1
9	Q54I10	0.62	36.2	528	0.028	0.053	MMSA_DICDI Probable methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Dictyostelium discoideum OX=44689 GN=mmsdh PE=3 SV=1
10	S6EZS3	0.84	36.2	1558	0.021	0.013	S6EZS3_CAEEL ABC transporter domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abt-1 PE=4 SV=1
11	Q99LG4	1.2	35.0	440	0.022	0.050	TTC5_MOUSE Tetratricopeptide repeat protein 5 OS=Mus musculus OX=10090 GN=Ttc5 PE=1 SV=2
12	Q9NFV6	3.2	34.3	1469	0.039	0.027	Q9NFV6_DROME TEP3 protein OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=2 SV=1
13	Q9VLY7	3.2	34.3	1469	0.039	0.027	Q9VLY7_DROME GH05679p OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=1 SV=2
14	Q8N0Z6	3.6	33.9	440	0.025	0.057	TTC5_HUMAN Tetratricopeptide repeat protein 5 OS=Homo sapiens OX=9606 GN=TTC5 PE=1 SV=2
15	Q9D994	7.7	32.3	303	0.014	0.046	WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus OX=10090 GN=Wdr38 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07774 EMC1_C	3.3e-71	250.9	ER membrane protein complex subunit 1, C-terminal
2	PF01011 PQQ	0.0072	27.2	PQQ enzyme repeat
3	PF13360 PQQ_2	4.2e-06	38.2	PQQ-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420608

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220853	0.999	ER membrane protein complex subunit 2
2	9606.ENSP00000245046	0.999	ER membrane protein complex subunit 3
3	9606.ENSP00000267750	0.999	ER membrane protein complex subunit 4
4	9606.ENSP00000334037	0.999	ER membrane protein complex subunit 10
5	9606.ENSP00000380322	0.999	ER membrane protein complex subunit 6
6	9606.ENSP00000253457	0.998	ER membrane protein complex subunit 8
7	9606.ENSP00000256545	0.998	ER membrane protein complex subunit 7
8	9606.ENSP00000306220	0.998	Membrane magnesium transporter 1
9	9606.ENSP00000403210	0.995	ER membrane protein complex subunit 9
10	9606.ENSP00000318147	0.861	ER degradation-enhancing alpha-mannosidase-like protein 3
11	9606.ENSP00000247461	0.772	Calnexin
12	9606.ENSP00000251296	0.725	Immunoglobulin superfamily member 21
13	9606.ENSP00000364403	0.723	E3 ubiquitin-protein ligase UBR4
14	9606.ENSP00000376615	0.719	5'-nucleotidase domain containing 3
15	9606.ENSP00000483491	0.716	Mitochondrial inner membrane protein OXA1L
16	9606.ENSP00000362532	0.712	Regulation of nuclear pre-mRNA domain-containing protein 1B
17	9606.ENSP00000478104	0.708	Vacuolar protein sorting 13 homolog D
18	9606.ENSP00000290231	0.694	Nuclear receptor coactivator 5
19	9606.ENSP00000403645	0.654	Transport and golgi organization 2 homolog
20	9606.ENSP00000392330	0.645	B-cell receptor-associated protein 31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032977	1.000	membrane insertase activity
GO:0005515	0.990	protein binding
GO:0003824	0.397	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0045048	0.955	protein insertion into ER membrane
GO:0008152	0.462	metabolic process
GO:0071704	0.428	organic substance metabolic process
GO:0071816	0.368	tail-anchored membrane protein insertion into ER membrane
GO:0044238	0.325	primary metabolic process
GO:0044237	0.310	cellular metabolic process
GO:0006807	0.303	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0031090	0.998	organelle membrane
GO:0032991	0.994	protein-containing complex
GO:0005789	0.979	endoplasmic reticulum membrane
GO:0098796	0.950	membrane protein complex
GO:0140534	0.899	endoplasmic reticulum protein-containing complex
GO:0072546	0.531	EMC complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]