StarFunc result for job id Q8N7C0

User Input

>input (313 residues)
MSLASGPGPGWLLFSFGMGLVSGSKCPNNCLCQAQEVICTGKQLTEYPLDIPLNTRRLFL
NENRITSLPAMHLGLLSDLVYLDCQNNRIREVMDYTFIGVFKLIYLDLSSNNLTSISPFT
FSVLSNLVQLNIANNPHLLSLHKFTFANTTSLRYLDLRNTGLQTLDSAALYHLTTLETLF
LSGNPWKCNCSFLDFAIFLIVFHMDPSDDLNATCVEPTELTGWPITRVGNPLRYMCITHL
DHKDYIFLLLIGFCIFAAGTVAAWLTGVCAVLYQNTRHKSSEEDEDEAGTRVEVSRRIFQ
TQTSSVQEFPQLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N7C0	1.000	1.000	2.141E-50	313	1.000	1.000	Q8N7C0.pdb.gz	LRC52_HUMAN Leucine-rich repeat-containing protein 52 OS=Homo sapiens OX=9606 GN=LRRC52 PE=1 SV=2
2	AFDB:Q5M8M9	0.819	0.817	4.559E-37	314	0.738	0.736	Q5M8M9.pdb.gz	LRC52_MOUSE Leucine-rich repeat-containing protein 52 OS=Mus musculus OX=10090 GN=Lrrc52 PE=1 SV=1
3	AFDB:Q6ZSA7	0.770	0.806	1.734E-17	298	0.300	0.315	Q6ZSA7.pdb.gz	LRC55_HUMAN Leucine-rich repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=LRRC55 PE=1 SV=3
4	AFDB:Q5VT99	0.713	0.756	4.479E-17	294	0.259	0.276	Q5VT99.pdb.gz	LRC38_HUMAN Leucine-rich repeat-containing protein 38 OS=Homo sapiens OX=9606 GN=LRRC38 PE=1 SV=1
5	AFDB:Q2I0M4	0.636	0.597	1.644E-14	334	0.262	0.246	Q2I0M4.pdb.gz	LRC26_HUMAN Leucine-rich repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=LRRC26 PE=1 SV=2
6	AFDB:A0A0R4ITS3	0.451	0.395	6.145E-14	372	0.281	0.237	A0A0R4ITS3.pdb.gz	A0A0R4ITS3_DANRE Trophoblast glycoprotein a OS=Danio rerio OX=7955 GN=YF-296 PE=4 SV=1
7	AFDB:Q9Z0L0	0.454	0.359	9.370E-14	426	0.307	0.225	Q9Z0L0.pdb.gz	TPBG_MOUSE Trophoblast glycoprotein OS=Mus musculus OX=10090 GN=Tpbg PE=1 SV=3
8	AFDB:Q8BHA1	0.601	0.373	6.709E-12	521	0.230	0.138	Q8BHA1.pdb.gz	LRC24_MOUSE Leucine-rich repeat-containing protein 24 OS=Mus musculus OX=10090 GN=Lrrc24 PE=2 SV=1
9	AFDB:D3Z8D8	0.544	0.264	1.023E-11	696	0.246	0.111	D3Z8D8.pdb.gz	D3Z8D8_RAT SLIT and NTRK-like family, member 1 OS=Rattus norvegicus OX=10116 GN=Slitrk1 PE=4 SV=1
10	AFDB:A8BB30	0.551	0.404	1.078E-11	444	0.201	0.142	A8BB30.pdb.gz
11	PDB:5y31B	0.452	0.293	1.641E-6	511	0.157	0.096	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
12	PDB:1xcdA	0.303	0.309	5.234E-6	305	0.141	0.144	1xcdA.pdb.gz
13	PDB:7tvfD	0.368	0.235	1.217E-5	515	0.131	0.080	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
14	PDB:6gffI	0.393	0.237	1.503E-5	551	0.153	0.087	6gffI.pdb.gz
15	PDB:2ft3F	0.319	0.326	2.062E-5	305	0.147	0.151	2ft3F.pdb.gz
16	PDB:5yq5B	0.353	0.359	3.144E-5	306	0.144	0.147	5yq5B.pdb.gz
17	PDB:7wv3A	0.324	0.178	5.053E-5	668	0.141	0.066	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
18	PDB:7wrqA	0.490	0.276	5.919E-5	566	0.163	0.090	7wrqA.pdb.gz
19	PDB:7lt9A	0.379	0.459	6.933E-5	251	0.134	0.167	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
20	PDB:3b2dA	0.457	0.251	1.612E-4	601	0.128	0.067	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N7C0	0.0	645	313	1.000	1.000	LRC52_HUMAN Leucine-rich repeat-containing protein 52 OS=Homo sapiens OX=9606 GN=LRRC52 PE=1 SV=2
2	Q5M8M9	2.56e-168	471	314	0.738	0.736	LRC52_MOUSE Leucine-rich repeat-containing protein 52 OS=Mus musculus OX=10090 GN=Lrrc52 PE=1 SV=1
3	Q6ZSA7	1.15e-38	140	298	0.304	0.319	LRC55_HUMAN Leucine-rich repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=LRRC55 PE=1 SV=3
4	Q5VT99	3.37e-27	109	294	0.220	0.235	LRC38_HUMAN Leucine-rich repeat-containing protein 38 OS=Homo sapiens OX=9606 GN=LRRC38 PE=1 SV=1
5	Q2I0M4	1.35e-21	95.1	334	0.227	0.213	LRC26_HUMAN Leucine-rich repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=LRRC26 PE=1 SV=2
6	O88279	1.74e-20	94.4	1531	0.198	0.040	SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1
7	Q80TR4	8.36e-20	92.4	1531	0.198	0.040	SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2
8	Q3Y6S4	2.17e-19	91.3	1532	0.208	0.042	Q3Y6S4_DANRE Slit homolog 1b precursor OS=Danio rerio OX=7955 GN=slit1b PE=2 SV=1
9	A0A0R4IU60	3.26e-19	90.5	1531	0.208	0.042	A0A0R4IU60_DANRE Slit homolog 1b (Drosophila) OS=Danio rerio OX=7955 GN=slit1b PE=4 SV=1
10	Q9Z0L0	7.59e-19	88.6	426	0.256	0.188	TPBG_MOUSE Trophoblast glycoprotein OS=Mus musculus OX=10090 GN=Tpbg PE=1 SV=3
11	O75093	8.84e-19	89.4	1534	0.192	0.039	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
12	G5EG78	1.02e-17	86.3	1328	0.182	0.043	PXDN2_CAEEL Peroxidasin homolog pxn-2 OS=Caenorhabditis elegans OX=6239 GN=pxn-2 PE=1 SV=1
13	A0A0R4ITS3	1.76e-17	84.0	372	0.265	0.223	A0A0R4ITS3_DANRE Trophoblast glycoprotein a OS=Danio rerio OX=7955 GN=YF-296 PE=4 SV=1
14	D2XV92	2.39e-17	85.1	1513	0.188	0.039	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
15	P0C192	3.40e-17	84.3	709	0.204	0.090	LRC4B_MOUSE Leucine-rich repeat-containing protein 4B OS=Mus musculus OX=10090 GN=Lrrc4b PE=1 SV=1
16	P0CC10	3.44e-17	84.3	709	0.204	0.090	LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus OX=10116 GN=Lrrc4b PE=1 SV=1
17	Q13641	4.89e-17	83.2	420	0.243	0.181	TPBG_HUMAN Trophoblast glycoprotein OS=Homo sapiens OX=9606 GN=TPBG PE=1 SV=1
18	P35859	6.17e-17	83.6	603	0.179	0.093	ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus OX=10116 GN=Igfals PE=1 SV=1
19	Q90XG4	1.04e-16	83.2	1095	0.201	0.058	Q90XG4_CHICK Slit-3 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
20	F1RCV3	1.07e-16	83.2	1516	0.195	0.040	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06305 LapA_dom	5e+02	11.9	Lipopolysaccharide assembly protein A domain
2	PF01462 LRRNT	0.02	25.8	Leucine rich repeat N-terminal domain
3	PF00560 LRR_1	6.2e+02	12.5	Leucine Rich Repeat
4	PF12799 LRR_4	6.8e-14	63.0	Leucine Rich repeats (2 copies)
5	PF13306 LRR_5	0.00038	31.8	BspA type Leucine rich repeat region (6 copies)
6	PF13855 LRR_8	2.4e-17	73.7	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294818

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382770	0.884	Potassium channel subfamily U member 1
2	9606.ENSP00000258111	0.845	Calcium-activated potassium channel subunit beta-4
3	9606.ENSP00000286628	0.818	Calcium-activated potassium channel subunit alpha-1
4	9606.ENSP00000319370	0.739	Calcium-activated potassium channel subunit beta-3
5	9606.ENSP00000356853	0.708	Uridine-cytidine kinase 2
6	9606.ENSP00000356849	0.706	Pogo transposable element derived with KRAB domain
7	9606.ENSP00000345667	0.698	Immunoglobulin-like domain-containing receptor 1
8	9606.ENSP00000480514	0.695	Calcium load-activated calcium channel
9	9606.ENSP00000356864	0.689	Microsomal glutathione S-transferase 3
10	9606.ENSP00000381247	0.670	EF-hand calcium-binding domain-containing protein 9
11	9606.ENSP00000274629	0.625	Calcium-activated potassium channel subunit beta-1
12	9606.ENSP00000317000	0.543	Transmembrane 6 superfamily member 1
13	9606.ENSP00000355166	0.519	Leucine-rich repeat-containing protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015459	0.998	potassium channel regulator activity
GO:0005249	0.997	voltage-gated potassium channel activity
GO:0044325	0.989	transmembrane transporter binding
GO:0099103	0.989	channel activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0051179	0.985	localization
GO:0065007	0.978	biological regulation
GO:0050794	0.966	regulation of cellular process
GO:0006813	0.966	potassium ion transport
GO:0098662	0.806	inorganic cation transmembrane transport
GO:0034220	0.754	monoatomic ion transmembrane transport
GO:0098655	0.703	monoatomic cation transmembrane transport
GO:0032879	0.654	regulation of localization
GO:0065009	0.635	regulation of molecular function
GO:0051049	0.620	regulation of transport
GO:0048518	0.530	positive regulation of biological process
GO:0032409	0.520	regulation of transporter activity
GO:1904062	0.519	regulation of monoatomic cation transmembrane transport
GO:0034767	0.518	positive regulation of monoatomic ion transmembrane transport
GO:0010959	0.516	regulation of metal ion transport
GO:0032414	0.418	positive regulation of ion transmembrane transporter activity
GO:1904064	0.417	positive regulation of cation transmembrane transport
GO:2001257	0.415	regulation of cation channel activity
GO:1901016	0.415	regulation of potassium ion transmembrane transporter activity
GO:2001259	0.414	positive regulation of cation channel activity
GO:0043268	0.397	positive regulation of potassium ion transport
GO:1901381	0.388	positive regulation of potassium ion transmembrane transport
GO:1901018	0.305	positive regulation of potassium ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.964	protein-containing complex
GO:0098796	0.885	membrane protein complex
GO:0034703	0.845	cation channel complex
GO:0034705	0.833	potassium channel complex
GO:0098797	0.699	plasma membrane protein complex
GO:0008076	0.622	voltage-gated potassium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]