StarFunc result for job id Q8N7E2

User Input

>input (425 residues)
MNKMPAGEQECEYNKEGKYYSKGVKLVRKKKKIPGYRWGDIKINIIGEKDDLPIHFCDKC
DLPIKIYGRIIPCKHAFCYHCANLYDKVGYKVCPRCRYPVLRIEAHKRGSVFMCSIVQQC
KRTYLSQKSLQAHIKRRHKRARKQVTSASLEKVRPHIAPPQTEISDIPKRLQDRDHLSYI
PPEQHTMVSLPSVQHMLQEQHNQPHKDIQAPPPELSLSLPFPIQWETVSIFTRKHGNLTV
DHIQNNSDSGAKKPTPPDYYPECQSQPAVSSPHHIIPQKQHYAPPPSPSSPVNHQMPYPP
QDVVTPNSVRSQVPALTTTYDPSSGYIIVKVPPDMNSPPLRAPQSQNGNPSASEFASHHY
NLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQR
RHRRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N7E2	0.999	0.999	5.873E-66	425	1.000	1.000	Q8N7E2.pdb.gz	CBLL2_HUMAN E3 ubiquitin-protein ligase CBLL2 OS=Homo sapiens OX=9606 GN=CBLL2 PE=1 SV=1
2	AFDB:Q5Z8R1	0.100	0.095	1.119E-2	455	0.205	0.191	Q5Z8R1.pdb.gz	IPI1_ORYSJ E3 ubiquitin-protein ligase IPI1 OS=Oryza sativa subsp. japonica OX=39947 GN=IPI1 PE=1 SV=1
3	PDB:5dkaA	0.115	0.467	2.977E-2	96	0.047	0.208	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
4	AFDB:B9EKI5	0.115	0.054	3.403E-2	938	0.146	0.066	B9EKI5.pdb.gz	B9EKI5_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=1
5	AFDB:A0A061I5T4	0.115	0.054	3.879E-2	934	0.153	0.070	A0A061I5T4.pdb.gz	A0A061I5T4_CRIGR E3 ubiquitin-protein ligase CBL (Fragment) OS=Cricetulus griseus OX=10029 GN=H671_4g13114 PE=1 SV=1
6	AFDB:Q13191	0.115	0.054	1.106E-1	982	0.162	0.070	Q13191.pdb.gz	CBLB_HUMAN E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2
7	AFDB:P22682	0.120	0.065	1.180E-1	913	0.165	0.077	P22682.pdb.gz	CBL_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cbl PE=1 SV=3
8	PDB:7lbmd	0.106	0.158	1.432E-1	275	0.028	0.044	7lbmd.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
9	AFDB:Q98TY6	0.113	0.055	1.534E-1	903	0.141	0.066	Q98TY6.pdb.gz	Q98TY6_CHICK E3 ubiquitin-protein ligase CBL OS=Gallus gallus OX=9031 PE=2 SV=1
10	AFDB:A0A0U1RR39	0.115	0.067	2.589E-1	862	0.134	0.066	A0A0U1RR39.pdb.gz	A0A0U1RR39_HUMAN E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=1
11	PDB:7egb0	0.106	0.182	3.142E-1	234	0.028	0.051	7egb0.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
12	AFDB:Q5EXX3	0.084	0.040	3.364E-1	1203	0.153	0.054	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
13	PDB:7nvr3	0.111	0.208	3.581E-1	214	0.031	0.061	7nvr3.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
14	PDB:5gm6a	0.117	0.369	4.358E-1	123	0.049	0.171	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	AFDB:Q9C7M2	0.069	0.046	4.371E-1	849	0.155	0.078	Q9C7M2.pdb.gz	Q9C7M2_ARATH Uncharacterized protein F14C21.55 OS=Arabidopsis thaliana OX=3702 GN=SED1 PE=1 SV=1
16	PDB:5a31B	0.104	0.399	6.455E-1	84	0.038	0.190	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
17	PDB:7oikA	0.087	0.011	6.455E-1	4426	0.035	0.003	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
18	PDB:4r8pL	0.110	0.180	6.892E-1	254	0.042	0.071	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
19	PDB:5gmkq	0.122	0.133	8.387E-1	387	0.028	0.031	5gmkq.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
20	PDB:3m62A	0.118	0.056	8.954E-1	955	0.021	0.009	3m62A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N7E2	0.0	874	425	1.000	1.000	CBLL2_HUMAN E3 ubiquitin-protein ligase CBLL2 OS=Homo sapiens OX=9606 GN=CBLL2 PE=1 SV=1
2	Q75N03	1.73e-106	325	491	0.504	0.436	HAKAI_HUMAN E3 ubiquitin-protein ligase Hakai OS=Homo sapiens OX=9606 GN=CBLL1 PE=1 SV=1
3	Q9JIY2	2.70e-106	325	491	0.501	0.434	HAKAI_MOUSE E3 ubiquitin-protein ligase Hakai OS=Mus musculus OX=10090 GN=Cbll1 PE=1 SV=1
4	M9PBE2	5.72e-25	108	473	0.127	0.114	HAKAI_DROME E3 ubiquitin-protein ligase Hakai OS=Drosophila melanogaster OX=7227 GN=Hakai PE=1 SV=1
5	C9K074	1.13e-17	80.9	123	0.089	0.309	C9K074_HUMAN Cbl proto-oncogene like 1 OS=Homo sapiens OX=9606 GN=CBLL1 PE=1 SV=2
6	Q9LFC0	1.09e-12	71.2	360	0.080	0.094	HAKAI_ARATH E3 ubiquitin-protein ligase HAKAI homolog OS=Arabidopsis thaliana OX=3702 GN=HAKAI PE=1 SV=1
7	O97273	0.001	43.5	365	0.061	0.071	O97273_PLAF7 Zinc finger protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315800 PE=4 SV=1
8	Q08AM8	0.11	37.4	729	0.042	0.025	Q08AM8_HUMAN SH3 domain containing ring finger 2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=1
9	Q8TEC5	0.11	37.4	729	0.042	0.025	SH3R2_HUMAN E3 ubiquitin-protein ligase SH3RF2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=3
10	K4P3M7	0.14	37.0	683	0.040	0.025	K4P3M7_9ALPH Immediate-early transactivator protein with Zn finger (Cell nucleus) OS=Bovine herpesvirus type 1.1 OX=79889 GN=BICP0 PE=1 SV=1
11	P29128	0.14	37.0	676	0.040	0.025	ICP0_BHV1J E3 ubiquitin-protein ligase ICP0 OS=Bovine herpesvirus 1.1 (strain Jura) OX=31518 GN=BICP0 PE=1 SV=1
12	Q08CC1	0.27	36.2	573	0.042	0.031	Q08CC1_DANRE FinTRIM family, member 82 OS=Danio rerio OX=7955 GN=si:dkey-252h13.6 PE=1 SV=1
13	Q86YF9	0.69	34.7	867	0.054	0.027	DZIP1_HUMAN Cilium assembly protein DZIP1 OS=Homo sapiens OX=9606 GN=DZIP1 PE=1 SV=1
14	A0A8I5XVZ9	0.71	34.7	526	0.042	0.034	A0A8I5XVZ9_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
15	P19474	0.75	34.7	475	0.033	0.029	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
16	A0A8I5ZQX4	0.80	34.3	514	0.042	0.035	A0A8I5ZQX4_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
17	Q498M5	0.89	34.3	735	0.040	0.023	SH3R2_RAT E3 ubiquitin-protein ligase SH3RF2 OS=Rattus norvegicus OX=10116 GN=Sh3rf2 PE=1 SV=1
18	Q5XIX1	0.90	34.3	432	0.042	0.042	Q5XIX1_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
19	A0A8I5ZJ72	1.0	34.3	577	0.042	0.031	A0A8I5ZJ72_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
20	P28990	1.0	34.3	532	0.033	0.026	ICP0_EHV1B E3 ubiquitin-protein ligase ICP0 OS=Equine herpesvirus 1 (strain Ab4p) OX=31520 GN=63 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12773 DZR	3.7e+02	12.5	Double zinc ribbon
2	PF18812 PBECR3	5.6e+02	11.9	phage-Barnase-EndoU-ColicinE5/D-RelE like nuclease3
3	PF14447 Prok-RING_4	4.6e+02	12.1	Prokaryotic RING finger family 4
4	PF13894 zf-C2H2_4	1.8e+02	14.4	C2H2-type zinc finger
5	PF00097 zf-C3HC4	1.4	20.2	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	0.71	21.1	Zinc finger, C3HC4 type (RING finger)
7	PF13639 zf-RING_2	2.4e+02	13.5	Ring finger domain
8	PF14634 zf-RING_5	9.1	17.7	zinc-RING finger domain
9	PF18408 zf_Hakai	1.6e-16	71.0	C2H2 Hakai zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323348

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351141	0.907	Pre-mRNA-splicing regulator WTAP
2	9606.ENSP00000297591	0.879	Protein virilizer homolog
3	9606.ENSP00000355979	0.839	SERTA domain containing 4
4	9606.ENSP00000282007	0.595	Zinc finger CCCH domain-containing protein 13
5	9606.ENSP00000255977	0.576	E3 ubiquitin-protein ligase makorin-1
6	9606.ENSP00000261769	0.567	Cadherin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019787	0.838	ubiquitin-like protein transferase activity
GO:0004842	0.777	ubiquitin-protein transferase activity
GO:0061659	0.377	ubiquitin-like protein ligase activity
GO:0061630	0.304	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0043170	0.979	macromolecule metabolic process
GO:0009987	0.976	cellular process
GO:0044237	0.972	cellular metabolic process
GO:0006807	0.952	nitrogen compound metabolic process
GO:0050789	0.934	regulation of biological process
GO:0043412	0.915	macromolecule modification
GO:0050794	0.840	regulation of cellular process
GO:1901564	0.744	organonitrogen compound metabolic process
GO:0044260	0.634	cellular macromolecule metabolic process
GO:0019538	0.615	protein metabolic process
GO:0036211	0.471	protein modification process
GO:0034641	0.455	cellular nitrogen compound metabolic process
GO:0060255	0.409	regulation of macromolecule metabolic process
GO:0016567	0.407	protein ubiquitination
GO:0006139	0.385	nucleobase-containing compound metabolic process
GO:0090304	0.374	nucleic acid metabolic process
GO:0048518	0.336	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.998	cytoplasm
GO:0032991	0.714	protein-containing complex
GO:0070013	0.657	intracellular organelle lumen
GO:0031981	0.637	nuclear lumen
GO:0005654	0.547	nucleoplasm
GO:0005829	0.473	cytosol
GO:1990234	0.325	transferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.838	Transferases.

[back to server]