StarFunc result for job id Q8N7F7

User Input

>input (174 residues)
MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYC
IGPNASINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQDAKAVLQLLRQEHEE
RLQKISLEHLEQLAQYLLAEEPHVEPAGERELEAKARPQSSCDMEEKEEAAADQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N7F7	1.000	1.000	1.703E-30	174	1.000	1.000	Q8N7F7.pdb.gz	UBL4B_HUMAN Ubiquitin-like protein 4B OS=Homo sapiens OX=9606 GN=UBL4B PE=1 SV=1
2	AFDB:B2GV38	0.458	0.507	1.732E-17	157	0.385	0.427	B2GV38.pdb.gz	UBL4A_RAT Ubiquitin-like protein 4A OS=Rattus norvegicus OX=10116 GN=Ubl4a PE=2 SV=1
3	AFDB:B7NZQ9	0.449	0.497	2.544E-17	157	0.385	0.427	B7NZQ9.pdb.gz	UBL4A_RABIT Ubiquitin-like protein 4A OS=Oryctolagus cuniculus OX=9986 GN=UBL4A PE=3 SV=1
4	AFDB:Q5HY81	0.593	0.576	8.121E-16	180	0.385	0.372	Q5HY81.pdb.gz	Q5HY81_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=2
5	AFDB:P15357	0.423	0.471	9.583E-10	156	0.138	0.154	P15357.pdb.gz	RS27A_DROME Ubiquitin-ribosomal protein eS31 fusion protein OS=Drosophila melanogaster OX=7227 GN=RpS27A PE=1 SV=2
6	AFDB:P49632	0.429	0.577	1.601E-9	128	0.149	0.203	P49632.pdb.gz	RL40_CAEEL Ubiquitin-ribosomal protein eL40 fusion protein OS=Caenorhabditis elegans OX=6239 GN=ubq-2 PE=3 SV=2
7	AFDB:P59232	0.426	0.471	1.601E-9	157	0.132	0.146	P59232.pdb.gz	R27AB_ARATH Ubiquitin-ribosomal protein eS31y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AB PE=2 SV=2
8	AFDB:Q5AZV1	0.430	0.908	2.206E-9	81	0.121	0.259	Q5AZV1.pdb.gz	Q5AZV1_EMENI Ubiquitin-like domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06179 PE=4 SV=1
9	AFDB:P0C016	0.423	0.489	2.508E-9	150	0.138	0.160	P0C016.pdb.gz	RS27A_SCHPO Ubiquitin-ribosomal protein eS31A fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi3 PE=1 SV=2
10	AFDB:B9DHA6	0.431	0.581	2.851E-9	128	0.121	0.164	B9DHA6.pdb.gz	RL40A_ARATH Ubiquitin-ribosomal protein eL40z fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPL40A PE=2 SV=1
11	PDB:6ef3u	0.387	0.856	1.494E-7	75	0.126	0.293	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
12	PDB:3dbhI	0.402	0.797	3.025E-7	86	0.109	0.221	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
13	PDB:3ai5A	0.401	0.235	3.438E-7	299	0.126	0.074	3ai5A.pdb.gz
14	PDB:6mdhA	0.405	0.471	4.168E-7	149	0.115	0.134	6mdhA.pdb.gz
15	PDB:6yvaC	0.406	0.455	5.052E-7	155	0.126	0.142	6yvaC.pdb.gz
16	PDB:4pyuA	0.401	0.890	1.322E-6	76	0.075	0.171	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
17	PDB:7rbsB	0.406	0.449	1.322E-6	157	0.115	0.127	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
18	PDB:3plvA	0.403	0.855	4.194E-6	80	0.092	0.200	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
19	PDB:3tixA	0.381	0.428	1.833E-5	153	0.121	0.137	3tixA.pdb.gz
20	PDB:4zynB	0.400	0.184	2.526E-5	385	0.086	0.039	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N7F7	1.21e-123	347	174	1.000	1.000	UBL4B_HUMAN Ubiquitin-like protein 4B OS=Homo sapiens OX=9606 GN=UBL4B PE=1 SV=1
2	B7NZQ9	1.66e-36	125	157	0.385	0.427	UBL4A_RABIT Ubiquitin-like protein 4A OS=Oryctolagus cuniculus OX=9986 GN=UBL4A PE=3 SV=1
3	B2GV38	2.00e-36	125	157	0.402	0.446	UBL4A_RAT Ubiquitin-like protein 4A OS=Rattus norvegicus OX=10116 GN=Ubl4a PE=2 SV=1
4	P11441	3.02e-35	122	157	0.385	0.427	UBL4A_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=1
5	Q5HY81	5.88e-33	117	180	0.374	0.361	Q5HY81_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=2
6	P0CH07	2.31e-06	47.0	128	0.126	0.172	RL402_SCHPO Ubiquitin-ribosomal protein eL40B fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uep1 PE=1 SV=1
7	Q6FTH4	2.74e-06	46.6	128	0.126	0.172	Q6FTH4_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G02475g PE=3 SV=2
8	P49632	2.83e-06	46.6	128	0.126	0.172	RL40_CAEEL Ubiquitin-ribosomal protein eL40 fusion protein OS=Caenorhabditis elegans OX=6239 GN=ubq-2 PE=3 SV=2
9	P0CH08	3.10e-06	46.6	128	0.126	0.172	RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40A PE=1 SV=1
10	P0CH09	3.10e-06	46.6	128	0.126	0.172	RL40B_YEAST Ubiquitin-ribosomal protein eL40B fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40B PE=1 SV=1
11	A2Q831	3.19e-06	46.6	128	0.126	0.172	A2Q831_ASPNC Contig An01c0080, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An01g02880 PE=3 SV=1
12	J3QS39	4.02e-06	45.4	93	0.126	0.237	J3QS39_HUMAN Ubiquitin B (Fragment) OS=Homo sapiens OX=9606 GN=UBB PE=1 SV=1
13	R9PY16	4.24e-06	47.8	301	0.132	0.076	R9PY16_DROME Ubiquitin-like domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Ubi-p5E5 PE=4 SV=1
14	Q8RUC6	4.48e-06	46.6	154	0.121	0.136	RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana OX=3702 GN=RUB2 PE=1 SV=3
15	P0C8R3	4.78e-06	46.2	150	0.126	0.147	RS27B_SCHPO Ubiquitin-ribosomal protein eS31B fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi5 PE=1 SV=2
16	Q5ADS0	4.97e-06	47.4	229	0.126	0.096	UBI4P_CANAL Polyubiquitin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBI4 PE=3 SV=1
17	E9Q5F6	5.56e-06	47.0	201	0.126	0.109	E9Q5F6_MOUSE Polyubiquitin-C (Fragment) OS=Mus musculus OX=10090 GN=Ubc PE=1 SV=1
18	P0C016	5.62e-06	46.2	150	0.126	0.147	RS27A_SCHPO Ubiquitin-ribosomal protein eS31A fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi3 PE=1 SV=2
19	Q3E7K8	5.96e-06	47.0	230	0.126	0.096	UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana OX=3702 GN=UBQ12 PE=3 SV=1
20	P0CG63	5.98e-06	47.4	381	0.126	0.058	UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBI4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10302 Dsc3_N	3.4e+02	13.2	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
2	PF11620 GABP-alpha	82	14.9	GA-binding protein alpha chain
3	PF11976 Rad60-SLD	0.077	24.1	Ubiquitin-2 like Rad60 SUMO-like
4	PF16207 RAWUL	4.1e+02	13.0	RAWUL domain RING finger- and WD40-associated ubiquitin-like
5	PF18396 TBK1_ULD	84	14.5	TANK binding kinase 1 ubiquitin-like domain
6	PF17840 Tugs	8.1e-21	85.2	Tethering Ubl4a to BAGS domain
7	PF00240 ubiquitin	1.9e-11	54.8	Ubiquitin family
8	PF11543 UN_NPL4	2.9e+02	13.4	Nuclear pore localisation protein NPL4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334044

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256246	0.910	Testis-expressed protein 15
2	9606.ENSP00000330199	0.906	Sodium-dependent neutral amino acid transporter SLC6A17
3	9606.ENSP00000358807	0.814	Homeobox protein aristaless-like 3
4	9606.ENSP00000262395	0.715	TNF receptor-associated factor 4
5	9606.ENSP00000388107	0.704	Ubiquitin-60S ribosomal protein L40
6	9606.ENSP00000272317	0.661	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000298283	0.637	60S ribosomal protein L10-like
8	9606.ENSP00000278572	0.634	40S ribosomal protein S3
9	9606.ENSP00000346050	0.615	40S ribosomal protein S3a
10	9606.ENSP00000339484	0.594	Zinc finger AN1-type containing 4
11	9606.ENSP00000365131	0.593	Large proline-rich protein BAG6
12	9606.ENSP00000374447	0.563	Leucine-rich repeat and calponin homology domain-containing protein 1
13	9606.ENSP00000296277	0.553	Ribosomal protein L39 like
14	9606.ENSP00000325836	0.549	GTP-binding protein Di-Ras1
15	9606.ENSP00000471277	0.533	Zinc finger protein 558
16	9606.ENSP00000480914	0.524	Fibronectin type III domain-containing protein 11
17	9606.ENSP00000414390	0.519	Uncharacterized protein C11orf70
18	9606.ENSP00000312770	0.517	UPF0565 protein C2orf69
19	9606.ENSP00000470972	0.508	40S ribosomal protein S19
20	9606.ENSP00000355315	0.500	Ribosomal protein L39

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.992	biological regulation
GO:0050789	0.979	regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0048522	0.935	positive regulation of cellular process
GO:0009987	0.824	cellular process
GO:0051222	0.808	positive regulation of protein transport
GO:1903747	0.799	regulation of establishment of protein localization to mitochondrion
GO:1903533	0.798	regulation of protein targeting
GO:0032388	0.788	positive regulation of intracellular transport
GO:0071704	0.691	organic substance metabolic process
GO:0006807	0.646	nitrogen compound metabolic process
GO:0090316	0.634	positive regulation of intracellular protein transport
GO:1901564	0.627	organonitrogen compound metabolic process
GO:0044238	0.623	primary metabolic process
GO:0044237	0.605	cellular metabolic process
GO:0043170	0.592	macromolecule metabolic process
GO:0019538	0.551	protein metabolic process
GO:0044260	0.484	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016020	0.950	membrane
GO:0043232	0.901	intracellular non-membrane-bounded organelle
GO:0032991	0.887	protein-containing complex
GO:0005730	0.364	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]