StarFunc result for job id Q8N7G0

User Input

>input (328 residues)
MAGHRPSNHFCPLPGSGGGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGICPGPDV
WRIPLGPLPHEFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDIS
GILKELQQLAKELRQKRLSLGYSQADVGIAVGALFGKVLSQTTICRFEAQQLSVANMWKL
RPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKPTPQQI
SHIAGCLQLQKDVVRVWFYNRSKMGSRPTNDASPREIVGTAGPPCPGAPVCFHLGLGLPV
DIPHYTRLYSAGVAHSSAPATTLGLLRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N7G0	1.000	1.000	1.715E-40	328	1.000	1.000	Q8N7G0.pdb.gz	PO5F2_HUMAN POU domain, class 5, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU5F2 PE=1 SV=1
2	AFDB:Q9DAC9	0.349	0.348	1.813E-24	329	0.665	0.663	Q9DAC9.pdb.gz	PO5F2_MOUSE POU domain, class 5, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou5f2 PE=2 SV=1
3	AFDB:A7Y7W2	0.238	0.203	3.520E-11	389	0.338	0.285	A7Y7W2.pdb.gz	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
4	AFDB:P20267	0.262	0.193	5.391E-11	451	0.311	0.226	P20267.pdb.gz	PO3F1_RAT POU domain, class 3, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou3f1 PE=2 SV=2
5	AFDB:O73861	0.247	0.219	1.326E-10	372	0.332	0.293	O73861.pdb.gz	O73861_CHICK POU domain protein OS=Gallus gallus OX=9031 GN=Oct-6 PE=3 SV=1
6	AFDB:P20264	0.258	0.172	3.419E-10	500	0.308	0.202	P20264.pdb.gz	PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU3F3 PE=1 SV=2
7	AFDB:Q2VUE0	0.252	0.315	4.132E-10	260	0.284	0.358	Q2VUE0.pdb.gz	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
8	AFDB:P20268	0.255	0.222	7.649E-10	380	0.262	0.226	P20268.pdb.gz	HM06_CAEEL Homeobox protein ceh-6 OS=Caenorhabditis elegans OX=6239 GN=ceh-6 PE=1 SV=3
9	AFDB:P25425	0.228	0.101	1.193E-8	770	0.280	0.119	P25425.pdb.gz	PO2F1_MOUSE POU domain, class 2, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou2f1 PE=1 SV=3
10	AFDB:H0YKT2	0.213	0.116	2.208E-8	618	0.299	0.159	H0YKT2.pdb.gz	H0YKT2_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=2
11	PDB:6t90K	0.217	0.949	3.365E-5	73	0.149	0.671	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
12	PDB:4egcA	0.139	0.085	6.702E-1	539	0.091	0.056	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:3rgkA	0.143	0.258	8.904E-1	149	0.058	0.128	3rgkA.pdb.gz	X-ray crystal structure of a recombinant human myoglobin mutant at 2.8 A resolution
14	PDB:3zc0B	0.150	0.214	1.364	191	0.088	0.152	3zc0B.pdb.gz	Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
15	PDB:1hbrD	0.121	0.206	1.812	146	0.070	0.158	1hbrD.pdb.gz	The structural and functional analysis of the hemoglobin D component from chicken.
16	PDB:2dc3A	0.146	0.232	1.812	172	0.055	0.105	2dc3A.pdb.gz	High-resolution structure of human cytoglobin: identification of extra N- and C-termini and a new dimerization mode.
17	PDB:2fuqA	0.169	0.084	1.900	747	0.052	0.023	2fuqA.pdb.gz	Crystal Structure of Heparinase II from Pedobacter heparinus and Its Complex with a Disaccharide Product.
18	PDB:3axjA	0.149	0.187	1.992	225	0.088	0.129	3axjA.pdb.gz
19	PDB:1fdhG	0.098	0.177	2.408	147	0.055	0.122	1fdhG.pdb.gz	Structure of human foetal deoxyhaemoglobin.
20	PDB:2bk9A	0.133	0.231	2.408	153	0.058	0.124	2bk9A.pdb.gz	Bishistidyl Heme Hexacoordination, a Key Structural Property in Drosophila Melanogaster Hemoglobin

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N7G0	0.0	662	328	1.000	1.000	PO5F2_HUMAN POU domain, class 5, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU5F2 PE=1 SV=1
2	Q9DAC9	5.10e-133	383	329	0.665	0.663	PO5F2_MOUSE POU domain, class 5, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou5f2 PE=2 SV=1
3	D2IYK3	3.31e-70	224	360	0.463	0.422	D2IYK3_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU5F1 PE=2 SV=1
4	Q01860	3.31e-70	224	360	0.463	0.422	PO5F1_HUMAN POU domain, class 5, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU5F1 PE=1 SV=1
5	Q6MG27	7.10e-70	223	352	0.491	0.457	Q6MG27_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou5f1 PE=2 SV=1
6	P20263	5.80e-69	221	352	0.488	0.455	PO5F1_MOUSE POU domain, class 5, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou5f1 PE=1 SV=1
7	Q06416	9.63e-65	210	359	0.439	0.401	P5F1B_HUMAN Putative POU domain, class 5, transcription factor 1B OS=Homo sapiens OX=9606 GN=POU5F1B PE=5 SV=2
8	A7Y7W2	2.96e-48	168	389	0.247	0.208	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
9	B7ZQA9	8.73e-43	155	445	0.250	0.184	P5F12_XENLA POU domain, class 5, transcription factor 1.2 OS=Xenopus laevis OX=8355 GN=pou5f1.2 PE=1 SV=1
10	Q7T103	9.38e-43	155	449	0.244	0.178	P5F11_XENLA POU domain, class 5, transcription factor 1.1 OS=Xenopus laevis OX=8355 GN=pou5f1.1 PE=1 SV=1
11	Q90270	4.57e-42	153	472	0.229	0.159	PO5F1_DANRE POU domain, class 5, transcription factor 1 OS=Danio rerio OX=7955 GN=pou5f1 PE=2 SV=1
12	A0A2R8Y739	5.00e-42	151	361	0.229	0.208	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
13	P62515	5.62e-42	151	361	0.229	0.208	PO3F4_MOUSE POU domain, class 3, transcription factor 4 OS=Mus musculus OX=10090 GN=Pou3f4 PE=2 SV=1
14	P62516	5.62e-42	151	361	0.229	0.208	PO3F4_RAT POU domain, class 3, transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Pou3f4 PE=2 SV=1
15	Q2VUE0	8.15e-42	147	260	0.223	0.281	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
16	P49335	2.29e-41	149	361	0.226	0.205	PO3F4_HUMAN POU domain, class 3, transcription factor 4 OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=2
17	P20265	1.78e-40	149	443	0.216	0.160	PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4
18	P31360	1.84e-40	149	445	0.216	0.160	PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou3f2 PE=1 SV=1
19	P20264	2.65e-40	149	500	0.229	0.150	PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU3F3 PE=1 SV=2
20	P31361	2.67e-40	149	497	0.229	0.151	PO3F3_MOUSE POU domain, class 3, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou3f3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	1e-06	39.8	Homeodomain
2	PF13560 HTH_31	2	20.1	Helix-turn-helix domain
3	PF00157 Pou	1.4e-27	106.8	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464890

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379294	0.534	Protein FAM172A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.997	sequence-specific DNA binding
GO:0003700	0.785	DNA-binding transcription factor activity
GO:1990837	0.633	sequence-specific double-stranded DNA binding
GO:0000981	0.460	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.395	transcription cis-regulatory region binding
GO:0001216	0.341	DNA-binding transcription activator activity
GO:0001228	0.322	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0010468	0.983	regulation of gene expression
GO:0080090	0.975	regulation of primary metabolic process
GO:0019219	0.974	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.972	regulation of macromolecule biosynthetic process
GO:0006355	0.963	regulation of DNA-templated transcription
GO:0032502	0.835	developmental process
GO:0006357	0.795	regulation of transcription by RNA polymerase II
GO:0048856	0.594	anatomical structure development
GO:0048519	0.485	negative regulation of biological process
GO:0048523	0.450	negative regulation of cellular process
GO:0048518	0.437	positive regulation of biological process
GO:0009893	0.388	positive regulation of metabolic process
GO:0048522	0.383	positive regulation of cellular process
GO:0010604	0.376	positive regulation of macromolecule metabolic process
GO:0051173	0.339	positive regulation of nitrogen compound metabolic process
GO:0031325	0.338	positive regulation of cellular metabolic process
GO:0045935	0.332	positive regulation of nucleobase-containing compound metabolic process
GO:0009892	0.321	negative regulation of metabolic process
GO:0010605	0.312	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.641	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]