StarFunc result for job id Q8N7J2

User Input

>input (671 residues)
METSRSRGGGGAVSERGGAGASVGVCRRKAEAGAGTGTLAADMDLHCDCAAETPAAEPPS
GKINKAAFKLFKKRKSGGTMPSIFGVKNKGDGKSSGPTGLVRSRTHDGLAEVLVLESGRK
EEPRGGGDSGGGGGGRPNPGPPRAAGPGGGSLASSSVAKSHSFFSLLKKNGRSENGKGEP
VDASKAGGKQKRGLRGLFSGMRWHRKDKRAKAEAAEGRAPGGGLILPGSLTASLECVKEE
TPRAAREPEEPSQDAPRDPAGEPAGGEEVPAPADRAPARSCREAEGLAHPGDTGARGEDA
AGHRRAEPGPGEVRTAEDASRTGAVPVKTVPLVDSEGGSGRAPAAPDPASVDPPSDPSAD
RICLMFSDVTSLKSFDSLTGCGDIIADQEEEAGPSCDKHVPGPGKPALSKKNPGVVAYQG
GGEEMASPDEVDDTYLQEFWDMLSQTEEQGPEPQEGAAKVAAALETKVVPETPKDTRCVE
AAKDASSVKRRRLNRIPIEPHPKEEPKHPEKEQQEGVPNSDEGYWDSTTPGPEEDSSSSG
KKAGIPRDSYSGDALYDLYADPDGSPATLPGGKDNEETSSLSRLKPVSPGTITCPLRTPG
SLLKDSKIPISIKHLTNLPSSHPVVHQQPSRSEMPRTKIPVSKVLVRRVSNRGLAGTTIR
ATACHDSAKKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N7J2	0.999	0.999	6.564E-96	671	1.000	1.000	Q8N7J2.pdb.gz	AMER2_HUMAN APC membrane recruitment protein 2 OS=Homo sapiens OX=9606 GN=AMER2 PE=1 SV=3
2	AFDB:F1RDM5	0.069	0.057	6.045E-11	930	0.259	0.187	F1RDM5.pdb.gz	AMER1_DANRE APC membrane recruitment protein 1 OS=Danio rerio OX=7955 GN=amer1 PE=2 SV=1
3	AFDB:D3ZJ47	0.051	0.041	5.014E-3	917	0.170	0.124	D3ZJ47.pdb.gz	MNAR1_RAT Major intrinsically disordered Notch2-binding receptor 1 OS=Rattus norvegicus OX=10116 GN=Minar1 PE=2 SV=3
4	AFDB:A0A1L8H8C0	0.059	0.045	1.574E-2	956	0.125	0.088	A0A1L8H8C0.pdb.gz	G2L2S_XENLA GAS2-like protein 2B OS=Xenopus laevis OX=8355 GN=gas2l2.S PE=3 SV=1
5	AFDB:Q9VLL3	0.056	0.051	9.407E-2	753	0.164	0.146	Q9VLL3.pdb.gz	AK200_DROME A-kinase anchor protein 200 OS=Drosophila melanogaster OX=7227 GN=Akap200 PE=1 SV=3
6	AFDB:E9QAP7	0.051	0.036	1.552E-1	1042	0.171	0.110	E9QAP7.pdb.gz	E9QAP7_MOUSE TATA-box binding protein associated factor 4 OS=Mus musculus OX=10090 GN=Taf4 PE=1 SV=1
7	AFDB:G5EEH9	0.059	0.031	2.560E-1	1678	0.161	0.064	G5EEH9.pdb.gz	NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans OX=6239 GN=npp-10 PE=1 SV=1
8	AFDB:E2J8V4	0.056	0.056	2.953E-1	677	0.134	0.133	E2J8V4.pdb.gz
9	AFDB:P52948	0.049	0.027	3.172E-1	1817	0.156	0.058	P52948.pdb.gz	NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4
10	AFDB:P53550	0.052	0.040	3.172E-1	970	0.136	0.094	P53550.pdb.gz	DCP2_YEAST m7GpppN-mRNA hydrolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCP2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N7J2	0.0	1331	671	1.000	1.000	AMER2_HUMAN APC membrane recruitment protein 2 OS=Homo sapiens OX=9606 GN=AMER2 PE=1 SV=3
2	Q6INC4	1.07e-173	511	624	0.474	0.510	AMER2_XENLA APC membrane recruitment protein 2 OS=Xenopus laevis OX=8355 GN=amer2 PE=2 SV=2
3	F1RDM5	5.17e-46	178	930	0.247	0.178	AMER1_DANRE APC membrane recruitment protein 1 OS=Danio rerio OX=7955 GN=amer1 PE=2 SV=1
4	Q5JTC6	1.31e-18	93.2	1135	0.188	0.111	AMER1_HUMAN APC membrane recruitment protein 1 OS=Homo sapiens OX=9606 GN=AMER1 PE=1 SV=2
5	Q8N944	1.58e-18	92.4	861	0.122	0.095	AMER3_HUMAN APC membrane recruitment protein 3 OS=Homo sapiens OX=9606 GN=AMER3 PE=1 SV=2
6	Q7TS75	3.79e-17	88.6	1132	0.183	0.109	AMER1_MOUSE APC membrane recruitment protein 1 OS=Mus musculus OX=10090 GN=Amer1 PE=2 SV=3
7	P17865	0.40	36.2	382	0.069	0.120	FTSZ_BACSU Cell division protein FtsZ OS=Bacillus subtilis (strain 168) OX=224308 GN=ftsZ PE=1 SV=3
8	P53890	9.0	32.0	448	0.049	0.074	BNI5_YEAST Bud neck protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNI5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09422 WTX	2.1e-197	668.7	WTX protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000426528

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316845	0.808	Rho guanine nucleotide exchange factor 4
2	9606.ENSP00000253401	0.716	Rho guanine nucleotide exchange factor 9
3	9606.ENSP00000371221	0.699	Myotubularin-related protein 6
4	9606.ENSP00000257600	0.614	E3 ubiquitin-protein ligase DTX1
5	9606.ENSP00000300571	0.595	G-protein coupled receptor family C group 5 member B
6	9606.ENSP00000352926	0.590	Transcriptional enhancer factor TEF-3
7	9606.ENSP00000397351	0.590	Delphilin
8	9606.ENSP00000357177	0.589	Rho guanine nucleotide exchange factor 11
9	9606.ENSP00000262753	0.588	Protein POF1B
10	9606.ENSP00000333363	0.580	Dynein heavy chain 8, axonemal
11	9606.ENSP00000340578	0.564	Ras association domain-containing protein 6
12	9606.ENSP00000375069	0.545	Collagen type XXIII alpha 1 chain
13	9606.ENSP00000264377	0.525	Disintegrin and metalloproteinase domain-containing protein 23
14	9606.ENSP00000417518	0.520	CLIP-associating protein 2
15	9606.ENSP00000410732	0.502	Gamma-aminobutyric acid receptor subunit gamma-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005546	1.000	phosphatidylinositol-4,5-bisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009966	0.928	regulation of signal transduction
GO:0030111	0.889	regulation of Wnt signaling pathway
GO:0060828	0.884	regulation of canonical Wnt signaling pathway
GO:0048523	0.875	negative regulation of cellular process
GO:0010648	0.855	negative regulation of cell communication
GO:0023057	0.847	negative regulation of signaling
GO:0030178	0.844	negative regulation of Wnt signaling pathway
GO:0090090	0.825	negative regulation of canonical Wnt signaling pathway
GO:0009987	0.412	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.926	intracellular anatomical structure
GO:0043226	0.875	organelle
GO:0005737	0.857	cytoplasm
GO:0043229	0.703	intracellular organelle
GO:0043227	0.534	membrane-bounded organelle
GO:0043231	0.301	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]