StarFunc result for job id Q8N7M2

User Input

>input (679 residues)
MESRSVAQAGVQWCDLGSLQAPPPGFTLFSCLSLLSSWDYSSGFSGFCASPIEESHGALI
SSCNSRTMTDGLVTFRDVAIDFSQEEWECLDPAQRDLYVDVMLENYSNLVSLDLESKTYE
TKKIFSENDIFEINFSQWEMKDKSKTLGLEASIFRNNWKCKSIFEGLKGHQEGYFSQMII
SYEKIPSYRKSKSLTPHQRIHNTEKSYVCKECGKACSHGSKLVQHERTHTAEKHFECKEC
GKNYLSAYQLNVHQRFHTGEKPYECKECGKTFSWGSSLVKHERIHTGEKPYECKECGKAF
SRGYHLTQHQKIHTGVKSYKCKECGKAFFWGSSLAKHEIIHTGEKPYKCKECGKAFSRGY
QLTQHQKIHTGKKPYECKICGKAFCWGYQLTRHQIFHTGEKPYECKECGKAFNCGSSLIQ
HERIHTGEKPYECKECGKAFSRGYHLSQHQKIHTGEKPFECKECGKAFSWGSSLVKHERV
HTGEKSHECKECGKTFCSGYQLTRHQVFHTGEKPYECKECGKAFNCGSSLVQHERIHTGE
KPYECKECGKAFSRGYHLTQHQKIHTGEKPFKCKECGKAFSWGSSLVKHERVHTNEKSYE
CKDCGKAFGSGYQLSVHQRFHTGEKLYQRKEFGKTFTCGSKLVHERTHSNDKPYKYNECG
EAFLWTTYSNEKIDTDETL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75290	0.351	0.369	9.314E-56	641	0.490	0.520	O75290.pdb.gz	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
2	AFDB:Q7Z3V5	0.508	0.560	2.206E-55	609	0.492	0.548	Q7Z3V5.pdb.gz	ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens OX=9606 GN=ZNF571 PE=2 SV=3
3	AFDB:Q8NDQ6	0.243	0.249	2.593E-55	660	0.482	0.495	Q8NDQ6.pdb.gz	ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens OX=9606 GN=ZNF540 PE=1 SV=1
4	AFDB:Q8TAQ5	0.359	0.357	2.593E-55	688	0.527	0.520	Q8TAQ5.pdb.gz	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
5	AFDB:Q6ECI4	0.377	0.364	5.024E-54	717	0.454	0.430	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
6	AFDB:P52742	0.327	0.335	2.397E-53	658	0.443	0.457	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
7	AFDB:Q5MCW4	0.509	0.504	2.530E-53	686	0.446	0.442	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
8	AFDB:Q05481	0.444	0.272	2.710E-52	1191	0.432	0.246	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
9	AFDB:Q96SK3	0.400	0.391	2.860E-52	696	0.439	0.428	Q96SK3.pdb.gz	ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens OX=9606 GN=ZNF607 PE=1 SV=3
10	AFDB:P35789	0.367	0.395	5.762E-52	620	0.433	0.474	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
11	PDB:3w5kB	0.078	0.294	5.653E-4	110	0.065	0.400	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.031	0.223	4.762E-1	62	0.019	0.210	6ydhA.pdb.gz
13	PDB:5dkaA	0.043	0.195	6.579E-1	96	0.027	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:6gejS	0.053	0.116	9.091E-1	208	0.047	0.154	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
15	PDB:7uhyC	0.043	0.048	1.013	578	0.025	0.029	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:5gm6a	0.031	0.124	1.399	123	0.038	0.211	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:6ff4t	0.038	0.117	1.476	172	0.054	0.215	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:7fikP	0.084	0.091	1.558	593	0.031	0.035	7fikP.pdb.gz
19	PDB:4r8pL	0.040	0.087	1.933	254	0.029	0.079	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
20	PDB:7dvqM	0.032	0.090	1.933	191	0.057	0.204	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RQ46	551	609	0.432	0.481	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
2	A6NNF4	544	616	0.449	0.495	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
3	K7EK80	560	552	0.443	0.545	K7EK80_HUMAN Zinc finger protein 540 (Fragment) OS=Homo sapiens OX=9606 GN=ZNF540 PE=4 SV=1
4	O75290	666	641	0.511	0.541	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
5	P10755	546	501	0.420	0.569	ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus OX=10090 GN=Zfp14 PE=2 SV=2
6	P17027	536	643	0.427	0.451	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
7	P35789	560	620	0.442	0.484	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
8	P51523	546	738	0.461	0.424	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
9	P52742	546	658	0.461	0.476	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
10	Q03923	540	595	0.442	0.504	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
11	Q05481	548	1191	0.470	0.268	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
12	Q14585	548	488	0.404	0.561	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
13	Q494X3	570	552	0.446	0.549	ZN404_HUMAN Zinc finger protein 404 OS=Homo sapiens OX=9606 GN=ZNF404 PE=1 SV=2
14	Q5MCW4	536	686	0.443	0.439	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
15	Q6ECI4	601	717	0.490	0.464	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
16	Q76KX8	548	674	0.443	0.447	ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens OX=9606 GN=ZNF534 PE=1 SV=1
17	Q7TMN8	550	578	0.390	0.458	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
18	Q7Z3V5	666	609	0.513	0.571	ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens OX=9606 GN=ZNF571 PE=2 SV=3
19	Q8BLA2	550	578	0.390	0.458	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
20	Q8IYB9	565	648	0.455	0.477	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	0.011	27.2	TFIIH C1-like domain
2	PF12552 DUF3741	14	17.0	Protein of unknown function (DUF3741)
3	PF19108 DUF5795	7.2	17.9	Family of unknown function (DUF5795)
4	PF19148 DUF5830	1.3e-06	39.7	Family of unknown function (DUF5830)
5	PF01352 KRAB	1.2e-22	90.5	KRAB box
6	PF01286 XPA_N	1.1e-07	43.1	XPA protein N-terminal
7	PF01428 zf-AN1	2e+02	13.5	AN1-like Zinc finger
8	PF00096 zf-C2H2	1.1e-55	194.2	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	1e-10	52.4	zinc-finger C2H2-type
10	PF13894 zf-C2H2_4	3.1e-37	135.0	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	8.1e-32	119.8	C2H2-type zinc finger
12	PF12171 zf-C2H2_jaz	3.8e-16	70.2	Zinc-finger double-stranded RNA-binding
13	PF13465 zf-H2C2_2	8e-127	419.9	Zinc-finger double domain
14	PF13451 zf-trcl	3.9	18.8	Probable zinc-ribbon domain
15	PF18439 zf_UBZ	0.0015	29.4	Ubiquitin-Binding Zinc Finger
16	PF17032 zinc_ribbon_15	0.039	26.0	zinc-ribbon family
17	PF09723 Zn-ribbon_8	1.1e-06	40.0	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484852

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269445	0.525	Dymeclin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0010468	0.987	regulation of gene expression
GO:0031323	0.977	regulation of cellular metabolic process
GO:0006355	0.968	regulation of DNA-templated transcription
GO:0009892	0.890	negative regulation of metabolic process
GO:0010605	0.878	negative regulation of macromolecule metabolic process
GO:0048523	0.870	negative regulation of cellular process
GO:0031324	0.755	negative regulation of cellular metabolic process
GO:0045934	0.722	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.707	negative regulation of biosynthetic process
GO:0051253	0.698	negative regulation of RNA metabolic process
GO:0010558	0.680	negative regulation of macromolecule biosynthetic process
GO:0031327	0.673	negative regulation of cellular biosynthetic process
GO:1902679	0.617	negative regulation of RNA biosynthetic process
GO:1903507	0.611	negative regulation of nucleic acid-templated transcription
GO:0009987	0.556	cellular process
GO:0045892	0.555	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.991	nucleoplasm
GO:0005737	0.974	cytoplasm
GO:0012505	0.916	endomembrane system
GO:0016020	0.837	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]