StarFunc result for job id Q8N7R7

User Input

>input (359 residues)
MGNTLTCCVSPNASPKLGRRAGSAELYCASDIYEAVSGDAVAVAPAVVEPAELDFGEGEG
HHLQHISDREMPEDLALESNPSDHPRASTIFLSKSQTDVREKRKSNHLNHVSPGQLTKKY
SSCSTIFLDDSTVSQPNLRTTVKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEE
YFKHDPEHKFIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPTNWKRIVLGAI
LLASKVWDDQAVWNVDYCQILKDITVEDMNEMERHFLELLQFNINVPASVYAKYYFDLRS
LADDNNLNFLFAPLSKERAQNLEAISRLCEDKDLCRAAMRRSFSADNFIGIQRSKAILS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3YUJ3	0.836	0.818	1.385E-47	367	0.925	0.905	D3YUJ3.pdb.gz	D3YUJ3_MOUSE Cyclin Y-like 1 OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
2	AFDB:E7F3H3	0.702	0.722	6.677E-38	349	0.708	0.728	E7F3H3.pdb.gz	E7F3H3_DANRE Cyclin Y OS=Danio rerio OX=7955 GN=ccny PE=3 SV=1
3	AFDB:Q9VKF0	0.712	0.632	1.982E-33	406	0.588	0.520	Q9VKF0.pdb.gz	Q9VKF0_DROME Cyclin Y, isoform A OS=Drosophila melanogaster OX=7227 GN=CycY PE=1 SV=1
4	AFDB:P34624	0.727	0.731	5.093E-31	357	0.504	0.507	P34624.pdb.gz	CCNY_CAEEL Cyclin-Y OS=Caenorhabditis elegans OX=6239 GN=cyy-1 PE=1 SV=3
5	AFDB:Q54ZC9	0.489	0.386	1.472E-17	463	0.301	0.233	Q54ZC9.pdb.gz	Q54ZC9_DICDI Cyclin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277667 PE=3 SV=1
6	AFDB:Q75J86	0.353	0.166	7.094E-8	798	0.167	0.075	Q75J86.pdb.gz	Q75J86_DICDI Cyclin-related 2 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277391 PE=4 SV=1
7	AFDB:P40186	0.390	0.481	1.058E-7	285	0.145	0.182	P40186.pdb.gz	PCL7_YEAST PHO85 cyclin-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCL7 PE=1 SV=3
8	AFDB:Q382C9	0.394	0.652	1.359E-7	211	0.103	0.175	Q382C9.pdb.gz	Q382C9_TRYB2 Cyclin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5660 PE=3 SV=1
9	AFDB:C8V078	0.303	0.444	2.876E-7	241	0.106	0.158	C8V078.pdb.gz	C8V078_EMENI Cyclin-dependent protein kinase complex component, putative (AFU_orthologue AFUA_2G07660) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10741 PE=4 SV=1
10	AFDB:O80513	0.379	0.646	1.655E-6	202	0.109	0.193	O80513.pdb.gz	CCU41_ARATH Cyclin-U4-1 OS=Arabidopsis thaliana OX=3702 GN=CYCU4-1 PE=1 SV=1
11	PDB:2pk9D	0.358	0.565	2.520E-4	219	0.092	0.151	2pk9D.pdb.gz
12	PDB:2w96A	0.256	0.356	2.157E-2	249	0.097	0.141	2w96A.pdb.gz
13	PDB:7b5lY	0.252	0.345	7.158E-2	253	0.078	0.111	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
14	PDB:5xjt2	0.097	0.134	1.946E-1	217	0.125	0.207	5xjt2.pdb.gz	Structures of 7S mutant complexes
15	PDB:7nj0C	0.244	0.318	2.260E-1	270	0.067	0.089	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
16	PDB:1g3nC	0.237	0.353	2.376E-1	233	0.053	0.082	1g3nC.pdb.gz
17	PDB:3g33B	0.234	0.355	4.551E-1	229	0.058	0.092	3g33B.pdb.gz
18	PDB:1ekuB	0.120	0.146	1.013	254	0.081	0.114	1ekuB.pdb.gz
19	PDB:7ru6A	0.079	0.086	1.013	315	0.033	0.038	7ru6A.pdb.gz	Antiviral HIV-1 SERINC restriction factors disrupt virus membrane asymmetry.
20	PDB:1xl8B	0.086	0.059	1.065	600	0.039	0.023	1xl8B.pdb.gz	Crystal structure of mouse carnitine octanoyltransferase and molecular determinants of substrate selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YUJ3	0.0	642	367	0.914	0.894	D3YUJ3_MOUSE Cyclin Y-like 1 OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
2	E9Q226	0.0	590	291	0.797	0.983	E9Q226_MOUSE Cyclin Y-like 1 OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
3	Q8N7R7	0.0	747	359	1.000	1.000	CCYL1_HUMAN Cyclin-Y-like protein 1 OS=Homo sapiens OX=9606 GN=CCNYL1 PE=1 SV=2
4	Q8ND76	1.46e-172	485	341	0.716	0.754	CCNY_HUMAN Cyclin-Y OS=Homo sapiens OX=9606 GN=CCNY PE=1 SV=2
5	Q8BGU5	1.31e-171	483	341	0.713	0.751	CCNY_MOUSE Cyclin-Y OS=Mus musculus OX=10090 GN=Ccny PE=1 SV=1
6	A0A286Y7Z8	2.61e-171	482	342	0.708	0.743	A0A286Y7Z8_DANRE Cyclin Y OS=Danio rerio OX=7955 GN=ccny PE=3 SV=2
7	E7F3H3	1.05e-168	476	349	0.708	0.728	E7F3H3_DANRE Cyclin Y OS=Danio rerio OX=7955 GN=ccny PE=3 SV=1
8	Q9VKF0	5.22e-132	385	406	0.557	0.493	Q9VKF0_DROME Cyclin Y, isoform A OS=Drosophila melanogaster OX=7227 GN=CycY PE=1 SV=1
9	P34624	3.01e-116	343	357	0.482	0.485	CCNY_CAEEL Cyclin-Y OS=Caenorhabditis elegans OX=6239 GN=cyy-1 PE=1 SV=3
10	A0A087WPI4	5.60e-55	177	85	0.234	0.988	A0A087WPI4_MOUSE Cyclin Y-like 1 (Fragment) OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
11	Q54ZC9	1.25e-52	182	463	0.240	0.186	Q54ZC9_DICDI Cyclin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277667 PE=3 SV=1
12	Q75J86	9.13e-10	62.4	798	0.089	0.040	Q75J86_DICDI Cyclin-related 2 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277391 PE=4 SV=1
13	Q6PGQ1	2.99e-08	55.8	229	0.109	0.170	DRIC1_HUMAN Aspartate-rich protein 1 OS=Homo sapiens OX=9606 GN=DRICH1 PE=1 SV=1
14	Q9FKF6	1.60e-06	50.8	219	0.084	0.137	CCU43_ARATH Cyclin-U4-3 OS=Arabidopsis thaliana OX=3702 GN=CYCU4-3 PE=1 SV=1
15	O80513	1.21e-05	47.8	202	0.084	0.149	CCU41_ARATH Cyclin-U4-1 OS=Arabidopsis thaliana OX=3702 GN=CYCU4-1 PE=1 SV=1
16	Q7K6A7	7.79e-05	45.8	229	0.070	0.109	Q7K6A7_PLAF7 Cyclin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518400 PE=3 SV=1
17	P24867	3.53e-04	44.3	279	0.089	0.115	PCL1_YEAST PHO85 cyclin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCL1 PE=1 SV=1
18	A0A1D8PNP1	0.060	37.4	373	0.070	0.067	A0A1D8PNP1_CANAL Pcl1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PCL1 PE=4 SV=1
19	Q9LJ45	0.14	35.8	210	0.078	0.133	CCU11_ARATH Cyclin-U1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCU1-1 PE=1 SV=1
20	P38794	0.54	34.3	229	0.078	0.122	PCL5_YEAST PHO85 cyclin-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCL5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08613 Cyclin	1.4e-06	40.2	Cyclin
2	PF00134 Cyclin_N	6.4e-12	56.7	Cyclin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008972517.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008960187.1	0.788	Cyclin-dependent kinase 16 isoform X1
2	9597.XP_003809800.1	0.614	Belongs to the protein kinase superfamily.
3	9597.XP_003827951.1	0.579	Belongs to the cyclin family.
4	9597.XP_003818326.1	0.540	Transmembrane channel like 6
5	9597.XP_003812890.1	0.535	Cell division cycle 20
6	9597.XP_008964485.1	0.531	Zinc finger protein 614
7	9597.XP_008967988.1	0.531	Zinc finger protein 211
8	9597.XP_003832670.1	0.503	Cyclin-dependent kinase 17 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.977	regulation of cellular process
GO:0009987	0.933	cellular process
GO:0032501	0.794	multicellular organismal process
GO:0051171	0.790	regulation of nitrogen compound metabolic process
GO:0080090	0.787	regulation of primary metabolic process
GO:0060255	0.786	regulation of macromolecule metabolic process
GO:0000003	0.755	reproduction
GO:0031323	0.582	regulation of cellular metabolic process
GO:0019953	0.498	sexual reproduction
GO:0022414	0.493	reproductive process
GO:0071840	0.367	cellular component organization or biogenesis
GO:0016043	0.351	cellular component organization
GO:0051246	0.317	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0071944	0.995	cell periphery
GO:0005886	0.993	plasma membrane
GO:0032991	0.858	protein-containing complex
GO:0043229	0.833	intracellular organelle
GO:0005737	0.817	cytoplasm
GO:0043231	0.817	intracellular membrane-bounded organelle
GO:1990234	0.625	transferase complex
GO:0000307	0.608	cyclin-dependent protein kinase holoenzyme complex
GO:0005634	0.576	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]