StarFunc result for job id Q8N7U6

User Input

>input (833 residues)
MNMEIGHPHEGKDDLGDKRVIMGTKFPMELGIRVGLGKEDSRCGESPVVSNKCEGRMAPP
ETKFPLSKGLEMGLERQNISRTVMQRGSLGVDSVSASQGTKPSLLPGRMGLENESLLAGY
THERIIQPPLGRVCGSSQAAGSRRAPLASGPEGVEELVGKPAFVMEPRQEMEKESTCVLM
KPNTEIKLPVEVDIGLTQAEGPDETKNTEPQMGLVIEPPQCQFAQQHEQRKEAGNIESGV
EPPDRIRPIYSGKFFDRTPCWPSAGKVIPVGYRVATCLTEKLPRLITPPEAKKYFNFRYP
PAGVERVFYGRANDPQIAPYLTHGIRSKISVLANTLINPQPITTFQQKIKDKKESIYLSN
RRAPLGKSHDQAPGLPKGMDTTNTTFGTAVIKEYSAKDVVNPPKSYEEVFKEGNEGHDLY
VVSHNDYYAGEAKNRKYNPSSFHRCSVYGVPTPHFNDGRAMAKSLYWLHELQMKRGAKFV
SKRADDFKEKFQHKLGRVLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEYLRG
KDRQRALIAAVRHHLKKVNYQKFDTLLAAFRHYDKKGDGMIDKDELQEACDQANLSLDDK
LLDQLFDYCDVDNDGFINYLEFANFLNWKDKMLLKEYEERVIIKGRKPDCVNPTEANVEE
PEQTLLIKPEDIVLKEAGSTEKTLRTLLRPSDKVSNYYKTTSSEINAIVGAIPSTCYPIC
GVPTIRSDIPAPRIRRISDRTNYGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEI
LCNIGVKLSDEEFENVWNLASKKHHRGEVCVENIRNVLDELRHADRIKCKTLM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N7U6	1.000	1.000	0.000	833	1.000	1.000	Q8N7U6.pdb.gz	EFHB_HUMAN EF-hand domain-containing family member B OS=Homo sapiens OX=9606 GN=EFHB PE=1 SV=4
2	AFDB:F1MMV1	0.314	0.300	4.343E-92	877	0.754	0.716	F1MMV1.pdb.gz	EFHB_BOVIN EF-hand domain-containing family member B OS=Bos taurus OX=9913 GN=EFHB PE=1 SV=3
3	PDB:7ung2	0.179	0.327	1.307E-56	446	0.534	0.998	7ung2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
4	PDB:7ung1	0.176	0.521	1.688E-34	272	0.324	0.993	7ung1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
5	PDB:7rro2	0.103	0.282	4.483E-23	292	0.286	0.815	7rro2.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
6	PDB:7rro1	0.126	0.615	1.572E-14	152	0.157	0.862	7rro1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
7	PDB:6hr1A	0.076	0.153	2.590E-3	406	0.028	0.057	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
8	AFDB:Q9VWK5	0.059	0.037	3.682E-3	1513	0.139	0.077	Q9VWK5.pdb.gz	Q9VWK5_DROME GH15225p OS=Drosophila melanogaster OX=7227 GN=Ulp1 PE=1 SV=1
9	PDB:6ya9A	0.072	0.148	4.402E-3	400	0.025	0.052	6ya9A.pdb.gz	Genetically encoded photo-switchable molecular sensors for optoacoustic and super-resolution imaging.
10	PDB:5a2hA	0.069	0.380	4.895E-3	147	0.028	0.156	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
11	PDB:1ggzA	0.075	0.420	6.729E-3	144	0.025	0.146	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
12	PDB:1osaA	0.075	0.405	6.729E-3	148	0.026	0.149	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
13	PDB:5d43A	0.076	0.351	8.319E-3	150	0.040	0.220	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
14	AFDB:A0A1D8PDD8	0.042	0.048	1.064E-2	708	0.114	0.134	A0A1D8PDD8.pdb.gz	A0A1D8PDD8_CANAL Tco89p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TCO89 PE=4 SV=1
15	AFDB:Q8CHD8	0.064	0.051	5.221E-2	1047	0.131	0.104	Q8CHD8.pdb.gz	RFIP3_MOUSE Rab11 family-interacting protein 3 OS=Mus musculus OX=10090 GN=Rab11fip3 PE=1 SV=2
16	AFDB:Q93073	0.050	0.042	5.505E-2	1101	0.148	0.112	Q93073.pdb.gz	SBP2L_HUMAN Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L PE=1 SV=3
17	AFDB:Q99MQ1	0.046	0.041	1.677E-1	977	0.112	0.095	Q99MQ1.pdb.gz	BICC1_MOUSE Protein bicaudal C homolog 1 OS=Mus musculus OX=10090 GN=Bicc1 PE=1 SV=1
18	AFDB:Q96R06	0.035	0.027	2.073E-1	1193	0.091	0.064	Q96R06.pdb.gz	SPAG5_HUMAN Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2
19	AFDB:A0A1D8PFD3	0.058	0.050	2.186E-1	1001	0.126	0.105	A0A1D8PFD3.pdb.gz	A0A1D8PFD3_CANAL Snt1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNT1 PE=4 SV=1
20	AFDB:F1RET1	0.047	0.025	2.702E-1	2248	0.130	0.048	F1RET1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1MMV1	0.0	1295	877	0.755	0.717	EFHB_BOVIN EF-hand domain-containing family member B OS=Bos taurus OX=9913 GN=EFHB PE=1 SV=3
2	Q8N7U6	0.0	1731	833	1.000	1.000	EFHB_HUMAN EF-hand domain-containing family member B OS=Homo sapiens OX=9606 GN=EFHB PE=1 SV=4
3	P48593	8.69e-09	58.5	193	0.034	0.145	E631_DROME Calcium-binding protein E63-1 OS=Drosophila melanogaster OX=7227 GN=Eip63F-1 PE=2 SV=2
4	Q9FXQ3	6.62e-08	58.5	551	0.038	0.058	CDPKD_ORYSJ Calcium-dependent protein kinase 13 OS=Oryza sativa subsp. japonica OX=39947 GN=CPK13 PE=2 SV=1
5	Q06850	1.03e-07	58.2	610	0.040	0.054	CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=CPK1 PE=1 SV=1
6	F4JTL3	2.27e-07	56.6	514	0.037	0.060	F4JTL3_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana OX=3702 GN=CPK26 PE=1 SV=1
7	P53684	3.60e-07	56.2	542	0.032	0.050	CDPK7_ORYSJ Calcium-dependent protein kinase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CPK7 PE=2 SV=2
8	Q38870	1.29e-06	54.3	646	0.036	0.046	CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana OX=3702 GN=CPK2 PE=1 SV=1
9	Q39016	1.80e-06	53.9	495	0.036	0.061	CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana OX=3702 GN=CPK11 PE=1 SV=2
10	P53682	2.80e-06	53.1	534	0.030	0.047	CDPKN_ORYSJ Calcium-dependent protein kinase 23 OS=Oryza sativa subsp. japonica OX=39947 GN=CPK23 PE=1 SV=2
11	Q38869	3.05e-06	53.1	501	0.036	0.060	CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana OX=3702 GN=CPK4 PE=1 SV=1
12	Q9NZT1	4.00e-06	49.7	146	0.032	0.185	CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens OX=9606 GN=CALML5 PE=1 SV=2
13	Q38871	4.97e-06	52.4	556	0.035	0.052	CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana OX=3702 GN=CPK5 PE=2 SV=1
14	P24044	6.21e-06	48.9	149	0.028	0.154	CALM_PLAFA Calmodulin OS=Plasmodium falciparum OX=5833 GN=CAM PE=1 SV=4
15	P62203	6.21e-06	48.9	149	0.028	0.154	CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=CAM PE=1 SV=2
16	Q8RWL2	6.56e-06	52.0	534	0.032	0.051	CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana OX=3702 GN=CPK29 PE=2 SV=2
17	Q383S0	7.05e-06	51.6	415	0.047	0.094	Q383S0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1850 PE=4 SV=1
18	Q38872	1.06e-05	51.2	544	0.032	0.050	CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana OX=3702 GN=CPK6 PE=1 SV=1
19	Q7XSQ5	1.56e-05	50.8	533	0.031	0.049	CDPKC_ORYSJ Calcium-dependent protein kinase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=CPK12 PE=2 SV=2
20	Q53P85	1.59e-05	50.8	513	0.036	0.058	CDPKO_ORYSJ Calcium-dependent protein kinase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=CPK24 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17743 DUF5580	3.3	17.8	Family of unknown function (DUF5580)
2	PF00036 EF-hand_1	1.9e-08	44.3	EF hand
3	PF14788 EF-hand_10	1.8e+02	13.5	EF hand
4	PF08976 EF-hand_11	22	17.3	EF-hand domain
5	PF12763 EF-hand_4	23	16.3	Cytoskeletal-regulatory complex EF hand
6	PF13202 EF-hand_5	0.00056	30.5	EF hand
7	PF13405 EF-hand_6	4.9e-07	40.1	EF-hand domain
8	PF13499 EF-hand_7	2.2e-06	39.3	EF-hand domain pair
9	PF13833 EF-hand_8	4.9	18.3	EF-hand domain pair
10	PF10591 SPARC_Ca_bdg	2.1	20.1	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295824

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380524	0.670	Calcyphosin-like protein
2	9606.ENSP00000385739	0.654	Carcinoembryonic antigen related cell adhesion molecule family
3	9606.ENSP00000478059	0.599	Stromal interaction molecule 1
4	9606.ENSP00000365585	0.506	Protein FAM182B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140299	1.000	small molecule sensor activity
GO:0005515	1.000	protein binding
GO:0005509	1.000	calcium ion binding
GO:0061891	0.579	calcium ion sensor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051100	0.988	negative regulation of binding
GO:1902531	0.986	regulation of intracellular signal transduction
GO:0032879	0.984	regulation of localization
GO:0043393	0.975	regulation of protein binding
GO:0050848	0.975	regulation of calcium-mediated signaling
GO:0043269	0.957	regulation of monoatomic ion transport
GO:0051924	0.954	regulation of calcium ion transport
GO:0106056	0.942	regulation of calcineurin-mediated signaling
GO:0032091	0.937	negative regulation of protein binding
GO:0070884	0.921	regulation of calcineurin-NFAT signaling cascade
GO:0009987	0.647	cellular process
GO:2001256	0.364	regulation of store-operated calcium entry

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0005856	0.997	cytoskeleton
GO:0015630	0.985	microtubule cytoskeleton
GO:0099080	0.981	supramolecular complex
GO:0005929	0.976	cilium
GO:0099513	0.959	polymeric cytoskeletal fiber
GO:0005874	0.938	microtubule
GO:0097014	0.913	ciliary plasm
GO:0005930	0.893	axoneme
GO:0005881	0.884	cytoplasmic microtubule
GO:0005879	0.671	axonemal microtubule
GO:0043231	0.660	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]