StarFunc result for job id Q8N7U7

User Input

>input (411 residues)
MLSLREQQLQVWFKNRRAKLARERRLQQQPQRVPGQRGRGARAAPLVPAASASAPQRGPS
GILPAAEPTICSLHQAWGGPGCRAQKGIPAALSPGPGPIPAPIPGPAQIPGPLPGSIPGP
IPGPAQIPSPIPAPIPGPISGPVQIPGPFRGPIPGPISGPAPIPGPISGPFSGPNPGPIP
GPNPGPIPGPISGPIPGPISVPIPGPIPGPISGPISGPNPGPIPGPIPGPISGPNPGPIP
GPISGPNPGLIPGPIPGPISGPGPIIGPIPSPAQIPGPGRLQGPGPILSPGRMRSPGSLP
GLAPILGPGSGPGSGSVPAPIPGPGSLPAPAPLWPQSPDASDFLPDTQLFPHFTELLLPL
DPLEGSSVSTMTSQYQEGDDSMGKKHSGSQPQEEGGSVNENHSGPRLLLDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N7U7	0.999	0.999	4.287E-52	411	1.000	1.000	Q8N7U7.pdb.gz	TPRX1_HUMAN Tetra-peptide repeat homeobox protein 1 OS=Homo sapiens OX=9606 GN=TPRX1 PE=1 SV=3
2	AFDB:Q8I3S3	0.112	0.034	1.558E-1	1894	0.119	0.026	Q8I3S3.pdb.gz	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
3	AFDB:Q9VTR6	0.078	0.028	3.051E-1	1713	0.197	0.047	Q9VTR6.pdb.gz	Q9VTR6_DROME Pericardin OS=Drosophila melanogaster OX=7227 GN=prc PE=1 SV=2
4	AFDB:P41809	0.074	0.024	2.434	1802	0.117	0.027	P41809.pdb.gz	HKR1_YEAST Signaling mucin HKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HKR1 PE=1 SV=2
5	AFDB:Q9NRR4	0.083	0.035	2.924	1374	0.192	0.057	Q9NRR4.pdb.gz	RNC_HUMAN Ribonuclease 3 OS=Homo sapiens OX=9606 GN=DROSHA PE=1 SV=2
6	AFDB:O65655	0.076	0.052	3.512	633	0.161	0.104	O65655.pdb.gz	O65655_ARATH SAP domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g39680 PE=1 SV=1
7	AFDB:A0A1D8PNL1	0.086	0.069	3.968	570	0.156	0.112	A0A1D8PNL1.pdb.gz	A0A1D8PNL1_CANAL Transcription factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MIG1 PE=4 SV=1
8	AFDB:C7C1L6	0.077	0.057	3.968	606	0.163	0.111	C7C1L6.pdb.gz	C7C1L6_SALSA Mitochondrial antiviral signaling OS=Salmo salar OX=8030 GN=mavs PE=2 SV=1
9	AFDB:O18381	0.069	0.038	3.968	857	0.197	0.095	O18381.pdb.gz	PAX6_DROME Paired box protein Pax-6 OS=Drosophila melanogaster OX=7227 GN=ey PE=1 SV=3
10	AFDB:Q585V1	0.082	0.056	6.085	713	0.197	0.114	Q585V1.pdb.gz	Q585V1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.50 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N7U7	0.0	720	411	1.000	1.000	TPRX1_HUMAN Tetra-peptide repeat homeobox protein 1 OS=Homo sapiens OX=9606 GN=TPRX1 PE=1 SV=3
2	P0DV77	1.59e-40	147	301	0.290	0.395	TPRX2_HUMAN Tetrapeptide repeat homeobox protein 2 OS=Homo sapiens OX=9606 GN=TPRX2 PE=2 SV=1
3	P16884	4.41e-15	79.7	1072	0.141	0.054	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4
4	Q9VSZ0	5.40e-11	63.9	205	0.095	0.190	Q9VSZ0_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Srg3 PE=4 SV=2
5	Q7K0W4	1.25e-08	58.5	328	0.114	0.143	Q7K0W4_DROME LD27203p OS=Drosophila melanogaster OX=7227 GN=Vajk4 PE=1 SV=1
6	P19246	5.21e-08	57.8	1090	0.124	0.047	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
7	Q9V3G8	3.65e-07	54.3	373	0.107	0.118	Q9V3G8_DROME RH73259p OS=Drosophila melanogaster OX=7227 GN=Vajk1 PE=2 SV=1
8	Q4GZE3	1.87e-06	52.8	1215	0.122	0.041	Q4GZE3_TRYB2 Metal-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.750 PE=4 SV=1
9	Q6ZRS2	4.05e-05	48.5	3230	0.114	0.015	SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP PE=1 SV=3
10	Q96KM6	5.10e-05	48.1	892	0.134	0.062	Z512B_HUMAN Zinc finger protein 512B OS=Homo sapiens OX=9606 GN=ZNF512B PE=1 SV=1
11	Q5T749	4.81e-04	44.7	579	0.102	0.073	KPRP_HUMAN Keratinocyte proline-rich protein OS=Homo sapiens OX=9606 GN=KPRP PE=1 SV=1
12	Q96IS3	0.002	41.6	184	0.097	0.217	RAX2_HUMAN Retina and anterior neural fold homeobox protein 2 OS=Homo sapiens OX=9606 GN=RAX2 PE=1 SV=1
13	O09116	0.006	40.4	238	0.141	0.244	SPRR3_MOUSE Small proline-rich protein 3 OS=Mus musculus OX=10090 GN=Sprr3 PE=2 SV=1
14	Q5H9F3	0.038	38.9	1785	0.134	0.031	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
15	P02831	0.039	38.5	443	0.024	0.023	HXA3_MOUSE Homeobox protein Hox-A3 OS=Mus musculus OX=10090 GN=Hoxa3 PE=1 SV=2
16	Q86BS0	0.042	38.9	1473	0.044	0.012	Q86BS0_DROME RIM-binding protein, isoform O OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
17	Q86BP0	0.044	38.5	1487	0.044	0.012	Q86BP0_DROME RIM-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
18	A0A0B4JCX2	0.046	38.5	1817	0.044	0.010	A0A0B4JCX2_DROME RIM-binding protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
19	A0A0B4KG12	0.046	38.5	1799	0.044	0.010	A0A0B4KG12_DROME RIM-binding protein, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
20	A0A126GUV2	0.046	38.5	1765	0.044	0.010	A0A126GUV2_DROME RIM-binding protein, isoform M OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	1.3	20.2	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323455

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400448	0.950	Tetra-peptide repeat homeobox-like
2	9606.ENSP00000365838	0.853	Divergent paired-related homeobox
3	9606.ENSP00000452398	0.804	Double homeobox protein A
4	9606.ENSP00000335578	0.803	Arginine-fifty homeobox
5	9606.ENSP00000380053	0.765	PRD class homeoboxes and pseudogenes
6	9606.ENSP00000221996	0.720	Cone-rod homeobox protein
7	9606.ENSP00000360455	0.717	Rhox homeobox family member 2B
8	9606.ENSP00000371553	0.630	NANOG neighbor homeobox
9	9606.ENSP00000360441	0.579	Rhox homeobox family member 2
10	9606.ENSP00000444503	0.518	Homeobox protein SEBOX
11	9606.ENSP00000297977	0.516	Highly divergent homeobox
12	9606.ENSP00000344729	0.509	Protein FAM166A
13	9606.ENSP00000450456	0.507	Retina and anterior neural fold homeobox protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043565	0.610	sequence-specific DNA binding
GO:0003690	0.505	double-stranded DNA binding
GO:1990837	0.493	sequence-specific double-stranded DNA binding
GO:0000976	0.395	transcription cis-regulatory region binding
GO:0000977	0.345	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	1.000	regulation of macromolecule metabolic process
GO:0010468	0.990	regulation of gene expression
GO:0050794	0.711	regulation of cellular process
GO:0031323	0.642	regulation of cellular metabolic process
GO:0019219	0.629	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.582	regulation of RNA metabolic process
GO:0010556	0.577	regulation of macromolecule biosynthetic process
GO:0031326	0.577	regulation of cellular biosynthetic process
GO:0006355	0.570	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005654	0.991	nucleoplasm
GO:0005737	0.740	cytoplasm
GO:0043232	0.412	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]