StarFunc result for job id Q8N7X0

User Input

>input (1667 residues)
MASKQTKKKEVHRINSAHGSDKSKDFYPFGSNVQSGSTEQKKGKFPLWPEWSEADINSEK
WDAGKGAKEKDKTGKSPVFHFFEDPEGKIELPPSLKIYSWKRPQDILFSQTPVVVKNEIT
FDLFSANEHLLCSELMRWIISEIYAVWKIFNGGILSNYFKGTSGEPPLLPWKPWEHIYSL
CKAVKGHMPLFNSYGKYVVKLYWMGCWRKITIDDFLPFDEDNNLLLPATTYEFELWPMLL
SKAIIKLANIDIHVADRRELGEFTVIHALTGWLPEVISLHPGYMDKVWELLKEILPEFKL
SDEASSESKIAVLDSKLKEPGKEGKEGKEIKDGKEVKDVKEFKPESSLTTLKAPEKSDKV
PKEKADARDIGKKRSKDGEKEKFKFSLHGSRPSSEVQYSVQSLSDCSSAIQTSHMVVYAT
FTPLYLFENKIFSLEKMADSAEKLREYGLSHICSHPVLVTRSRSCPLVAPPKPPPLPPWK
LIRQKKETVITDEAQELIVKKPERFLEISSPFLNYRMTPFTIPTEMHFVRSLIKKGIPPG
SDLPSVSETDETATHSQTDLSQITKATSQGNTASQVILGKGTDEQTDFGLGDAHQSDGLN
LEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQK
SEFKFSEERVSYYLFVDSLKPIELLVCFSALVRWGEYGALTKDSPPIEPGLLTAETFSWK
SLKPGSLVLKIHTYATKATVVRLPVGRHMLLFNAYSPVGHSIHICSMVSFVIGDEHVVLP
NFEPESCRFTEQSLLIMKAIGNVIANFKDKGKLSAALKDLQTAHYPVPFHDKELTAQHFR
VFHLSLWRLMKKVQITKPPPNFKFAFRAMVLDLELLNSSLEEVSLVEWLDVKYCMPTSDK
EYSAEEVAAAIKIQAMWRGTYVRLLMKARIPDTKENISVADTLQKVWAVLEMNLEQYAVS
LLRLMFKSKCKSLESYPCYQDEETKIAFADYTVTYQEQPPNSWFIVFRETFLVHQDMILV
PKVYTTLPICILHIVNNDTMEQVPKVFQKVVPYLYTKNKKGYTFVAEAFTGDTYVAASRW
KLRLIGSSAPLPCLSRDSPCNSFAIKEIRDYYIPNDKKILFRYSVKVLTPQPATIQVRTS
KPDAFIKLQVLENEETMVSSTGKGQAIIPAFHFLKSEKGLSSQSSKHILSFHSASKKEQE
VYVKKKAAQGIQKSPKGRAVSAIQDIGLPLVEEETTSTPTREDSSSTPLQNYKYIIQCSV
LYNSWPLTESQLTFVQALKDLKKSNTKAYGERHEELINLGSPDSHTISEGQKSSVTSKTT
RKGKEKSSEKEKTAKEKQAPRFEPQISTVHPQQEDPNKPYWILRLVTEHNESELFEVKKD
TERADEIRAMKQAWETTEPGRAIKASQARLHYLSGFIKKTSDAESPPISESQTKPKEEVE
TAARGVKEPNSKNSAGSESKEMTQTGSGSAVWKKWQLTKGLRDVAKSTSSESGGVSSPGK
EEREQSTRKENIQTGPRTRSPTILETSPRLIRKALEFMDLSQYVRKTDTDPLLQTDELNQ
QQAMQKAEEIHQFRQHRTRVLSIRNIDQEERLKLKDEVLDMYKEMQDSLDEARQKIFDIR
EEYRNKLLEAEHLKLETLAAQEAAMKLETEKMTPAPDTQKKKKGKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3UZ78	0.843	0.847	0.000	1657	0.737	0.741	G3UZ78.pdb.gz	ADGB_MOUSE Androglobin OS=Mus musculus OX=10090 GN=Adgb PE=1 SV=1
2	PDB:1kfuL	0.172	0.372	1.245E-4	699	0.038	0.092	1kfuL.pdb.gz
3	PDB:1kfxL	0.173	0.401	1.041E-3	640	0.044	0.116	1kfxL.pdb.gz
4	PDB:6l4cC	0.042	0.158	6.682E-3	353	0.024	0.113	6l4cC.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
5	PDB:3mguA	0.063	0.149	7.836E-3	533	0.028	0.086	3mguA.pdb.gz	Structural and functional insights into S. cerevisiae Tpa1, a putative prolyl hydroxylase influencing translation termination and transcription
6	PDB:3j4qB	0.040	0.137	2.956E-2	382	0.028	0.120	3j4qB.pdb.gz
7	PDB:7ua3A	0.063	0.033	3.287E-2	4443	0.036	0.014	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
8	AFDB:Q8I1Y8	0.069	0.053	4.199E-2	2271	0.099	0.073	Q8I1Y8.pdb.gz	Q8I1Y8_PLAF7 AP2 domain transcription factor AP2-SP2, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0404100 PE=4 SV=2
9	PDB:5imjA	0.043	0.181	6.217E-2	246	0.023	0.159	5imjA.pdb.gz
10	AFDB:Q9V9S7	0.053	0.049	7.142E-2	1866	0.107	0.095	Q9V9S7.pdb.gz	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
11	AFDB:Q9NZM4	0.036	0.038	8.833E-2	1560	0.094	0.100	Q9NZM4.pdb.gz	BICRA_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein OS=Homo sapiens OX=9606 GN=BICRA PE=1 SV=2
12	AFDB:E1JJ76	0.030	0.038	1.092E-1	1165	0.106	0.152	E1JJ76.pdb.gz	E1JJ76_DROME Alhambra, isoform H OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
13	AFDB:Q8K371	0.056	0.114	1.671E-1	772	0.037	0.079	Q8K371.pdb.gz	AMOL2_MOUSE Angiomotin-like protein 2 OS=Mus musculus OX=10090 GN=Amotl2 PE=1 SV=1
14	PDB:5eiyB	0.060	0.128	1.705E-1	658	0.026	0.067	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
15	PDB:6h03A	0.040	0.049	1.705E-1	1223	0.035	0.047	6h03A.pdb.gz
16	AFDB:Q5VT97	0.044	0.054	1.762E-1	1194	0.066	0.092	Q5VT97.pdb.gz	SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2
17	PDB:4rtdA	0.045	0.059	1.896E-1	1122	0.044	0.065	4rtdA.pdb.gz
18	AFDB:E1JI78	0.054	0.040	2.179E-1	2528	0.107	0.070	E1JI78.pdb.gz	E1JI78_DROME Formin homology 2 domain containing, isoform I OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
19	AFDB:Q94185	0.055	0.072	2.423E-1	1254	0.109	0.144	Q94185.pdb.gz	Q94185_CAEEL DumPY: shorter than wild-type OS=Caenorhabditis elegans OX=6239 GN=dpy-6 PE=1 SV=2
20	AFDB:F4HWC3	0.031	0.036	4.345E-1	1364	0.116	0.141	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3UZ78	0.0	2469	1657	0.738	0.743	ADGB_MOUSE Androglobin OS=Mus musculus OX=10090 GN=Adgb PE=1 SV=1
2	Q9R1S8	1.78e-11	71.6	813	0.037	0.076	CAN7_MOUSE Calpain-7 OS=Mus musculus OX=10090 GN=Capn7 PE=2 SV=1
3	Q7Z479	3.25e-11	70.9	813	0.037	0.076	Q7Z479_HUMAN Calpain 7 OS=Homo sapiens OX=9606 GN=CAPN7 PE=1 SV=1
4	Q9Y6W3	3.28e-11	70.9	813	0.037	0.076	CAN7_HUMAN Calpain-7 OS=Homo sapiens OX=9606 GN=CAPN7 PE=1 SV=1
5	Q00204	4.44e-08	60.5	847	0.028	0.054	PALB_EMENI Calpain-like protease palB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=palB PE=3 SV=2
6	Q584X4	1.73e-04	48.9	1010	0.014	0.023	Q584X4_TRYB2 Calpain-like cysteine peptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.670 PE=4 SV=1
7	Q5AK25	0.015	42.4	717	0.018	0.042	PALB_CANAL Calpain-like protease palB/RIM13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIM13 PE=3 SV=1
8	O75808	0.037	41.2	1086	0.023	0.035	CAN15_HUMAN Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1
9	O35646	0.23	38.5	641	0.022	0.056	CAN6_MOUSE Calpain-6 OS=Mus musculus OX=10090 GN=Capn6 PE=1 SV=2
10	Q57XZ9	0.59	37.4	853	0.013	0.026	Q57XZ9_TRYB2 Cytoskeleton-associated protein CAP5.5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.740 PE=4 SV=1
11	Q57WJ7	0.68	37.0	888	0.013	0.025	Q57WJ7_TRYB2 Calpain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28A12.350 PE=4 SV=1
12	Q9U1N0	1.2	36.2	535	0.018	0.056	HRP65_CHITE Hrp65 protein OS=Chironomus tentans OX=7153 GN=HRP65 PE=1 SV=1
13	Q9Y6Q1	1.3	36.2	641	0.021	0.055	CAN6_HUMAN Calpain-6 OS=Homo sapiens OX=9606 GN=CAPN6 PE=1 SV=2
14	Q22036	1.4	36.2	648	0.011	0.029	CAN5_CAEEL Calpain-5 OS=Caenorhabditis elegans OX=6239 GN=tra-3 PE=1 SV=1
15	P27398	1.5	36.2	1594	0.011	0.011	CAND_DROME Calpain-D OS=Drosophila melanogaster OX=7227 GN=sol PE=1 SV=2
16	Q9VXH6	1.6	35.8	681	0.013	0.031	CANC_DROME Calpain-C OS=Drosophila melanogaster OX=7227 GN=CalpC PE=1 SV=4
17	P54611	1.8	35.0	226	0.013	0.097	VATE_DROME V-type proton ATPase subunit E OS=Drosophila melanogaster OX=7227 GN=Vha26 PE=1 SV=1
18	Q23529	2.1	35.4	777	0.011	0.023	HOOK_CAEEL Zygote defective protein 12 OS=Caenorhabditis elegans OX=6239 GN=zyg-12 PE=1 SV=5
19	P47134	2.6	35.0	954	0.031	0.055	BIR1_YEAST Protein BIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BIR1 PE=1 SV=1
20	Q6ZFZ4	2.7	35.4	2162	0.011	0.008	DEK1_ORYSJ Calpain-type cysteine protease ADL1 OS=Oryza sativa subsp. japonica OX=39947 GN=ADL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00042 Globin	3.7	19.5	Globin
2	PF00612 IQ	44	15.2	IQ calmodulin-binding motif
3	PF00648 Peptidase_C2	2.1e-07	41.9	Calpain family cysteine protease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381036

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293230	0.759	Cytoglobin
2	9606.ENSP00000298352	0.707	Neuroglobin
3	9606.ENSP00000361664	0.617	Transcription factor HIVEP3
4	9606.ENSP00000258955	0.601	Radical S-adenosyl methionine domain-containing protein 1, mitochondrial
5	9606.ENSP00000316518	0.594	Olfactory receptor 9A2
6	9606.ENSP00000380489	0.587	Myoglobin
7	9606.ENSP00000401498	0.557	Uncharacterized protein C11orf94
8	9606.ENSP00000253697	0.555	Uncharacterized protein C3orf20
9	9606.ENSP00000427130	0.548	Ankyrin repeat domain-containing protein 13D
10	9606.ENSP00000425715	0.541	Coiled-coil domain containing 149
11	9606.ENSP00000455854	0.529	Testis-expressed protein 38
12	9606.ENSP00000295055	0.523	Calpain-13
13	9606.ENSP00000268624	0.509	Adenosine deaminase domain containing 2
14	9606.ENSP00000407213	0.500	IQ motif containing with AAA domain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.340	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.947	multicellular organismal process
GO:0032502	0.895	developmental process
GO:0007283	0.728	spermatogenesis
GO:0009987	0.647	cellular process
GO:0065007	0.340	biological regulation
GO:0050789	0.328	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036126	0.997	sperm flagellum
GO:0097225	0.982	sperm midpiece
GO:0005622	0.955	intracellular anatomical structure
GO:0005737	0.939	cytoplasm
GO:0097227	0.756	sperm annulus
GO:0043229	0.556	intracellular organelle
GO:0005829	0.434	cytosol
GO:0012505	0.338	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]