StarFunc result for job id Q8N7X1

User Input

>input (1067 residues)
MMEADRPEKLFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPA
DAKAAARDMNGKYLDGKAIMVAQTIKPAFKSSRWVPPTPGSGSRSRFSHRTRGGGSSPQR
PPSQGRPDDGRGYAGYFDLWPYRAPMPRKRGPPPRHWASPPHKRATPSSLAHSVGCGMRG
KAPTVSGQDGYSGLQPRRWAGPPHKRAVPRSSLARIGGSGMPGKAPAVWGQDGYSGPRVR
EPLPPCRDPGDFVPALRDYSRRYYGHSSVPDYRPLRGDGNQNGYRGRDHEYTDHPSKGSY
REPLKSYGGPCGAAPVWGTPPSYGGGCRYEEYQGNSPDACSEGRSSEALPVVLPDAYSRD
HSPKAYSGGRSSSSNGYSRSDRYGEEGCYEEYRGRSPDAHSGGRNSSSNSYGQSHHYGGE
GRYEEYRGRSHEARSGGRSTDAHSRGRSDDAYSGGHDSSSWSDCCGGGGRYEEYQGRSLD
ANSGGCSPEAYSGGHDNSSWSDRYGVGGHYEENRGHSLDANSGGRSPDTHSGGHSSSSNS
YGQSHRYGGEGRYEYRGRSHDAHSGGCSADAYSGGHDSSSQSNRYGGGGCYEEYRGRSLD
ANSGGRSPNAYSGGHDSSSWSHRYGGGGRYEEYRGRSLDANSGGRSPDAYSGGHDSSGQS
NCYGGGGRYEEYRGRLLDANSGGRSPDAYSGGHDSSSQSNRYGGGGRYEEYRGHSLDANS
GGRSPDTYSRGHDSSSQSDHYGGGGRSLDANSSGRLPDAYSGGHDSSSRSHRYGGGGRYE
EYRGRSLDANSGGRSPNAYSGGHNSSSRNDPCRGGGRYEENRGHSLDANSGGHSPNAYSG
GRDSSSNSYDRSHRYGGGGHYEEYRGRSHDTHSRGRSPDAHSGDHYTEAYSRGRDSFSNS
YGRSDHYGRGGCYEEYQGRSPNAYGGGRGLNSSNNSHGRSHRYGGGGRYEEYRGPSPDAH
SGGRDSSIKSYGLSDRYGGGGHYEEYQGSLPDAYSGDHDRSSNSYGRSDRYSRGRDRVGR
PDRGLPLPMETGSPPLHDSYSRSGCRVPRGGGRQGGRFERGEGRSRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5yzg1	0.071	0.309	6.555E-9	243	0.030	0.132	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
2	PDB:7dvqY	0.076	0.550	1.034E-8	140	0.026	0.200	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
3	PDB:5xjcw	0.073	0.827	1.529E-8	91	0.022	0.264	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
4	AFDB:Q5LJZ2	0.084	0.057	1.753E-8	1641	0.155	0.101	Q5LJZ2.pdb.gz	SET1_DROME Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster OX=7227 GN=Set1 PE=1 SV=1
5	PDB:6qx91K	0.077	0.389	2.575E-8	201	0.024	0.129	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
6	PDB:5gm6V	0.076	0.602	3.341E-8	128	0.022	0.188	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
7	PDB:6y53o	0.070	0.451	4.628E-8	160	0.025	0.169	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
8	PDB:1hl6A	0.072	0.631	4.939E-8	119	0.022	0.202	1hl6A.pdb.gz
9	PDB:6gd1A	0.072	0.397	5.627E-8	190	0.024	0.137	6gd1A.pdb.gz
10	PDB:6n7pA	0.071	0.400	3.061E-7	186	0.024	0.140	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
11	PDB:6qw6R	0.076	0.690	3.267E-7	106	0.023	0.236	6qw6R.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	AFDB:Q1LY77	0.076	0.045	8.185E-7	1844	0.188	0.109	Q1LY77.pdb.gz	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2
13	AFDB:Q8CFT2	0.086	0.050	1.676E-6	1985	0.172	0.092	Q8CFT2.pdb.gz	SET1B_MOUSE Histone-lysine N-methyltransferase SETD1B OS=Mus musculus OX=10090 GN=Setd1b PE=1 SV=2
14	AFDB:Q9UPS6	0.088	0.052	3.432E-6	1966	0.179	0.097	Q9UPS6.pdb.gz	SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3
15	AFDB:E9PYH6	0.081	0.052	1.183E-5	1716	0.161	0.100	E9PYH6.pdb.gz	SET1A_MOUSE Histone-lysine N-methyltransferase SETD1A OS=Mus musculus OX=10090 GN=Setd1a PE=1 SV=1
16	AFDB:O43426	0.062	0.043	2.946E-5	1573	0.112	0.076	O43426.pdb.gz	SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens OX=9606 GN=SYNJ1 PE=1 SV=2
17	AFDB:F4JXH7	0.078	0.083	1.084E-4	987	0.137	0.148	F4JXH7.pdb.gz	F4JXH7_ARATH RNA binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g60170 PE=1 SV=1
18	AFDB:Q9UPN6	0.068	0.057	1.318E-4	1271	0.113	0.095	Q9UPN6.pdb.gz	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
19	AFDB:Q9M1E4	0.070	0.075	3.503E-4	989	0.147	0.159	Q9M1E4.pdb.gz	Q9M1E4_ARATH RNA binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=F9K21.210 PE=1 SV=1
20	AFDB:Q9I7T7	0.064	0.046	8.720E-4	1531	0.169	0.118	Q9I7T7.pdb.gz	LAR4_DROME La-related protein Larp4B OS=Drosophila melanogaster OX=7227 GN=Larp4B PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P84586	1.34e-61	217	388	0.147	0.405	RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus OX=10116 GN=Rbmxrtl PE=1 SV=1
2	Q91VM5	1.69e-61	217	388	0.147	0.405	RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus OX=10090 GN=Rbmxl1 PE=2 SV=1
3	Q4V898	3.35e-59	210	390	0.153	0.418	RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus OX=10116 GN=Rbmx PE=1 SV=1
4	P38159	2.19e-57	205	391	0.152	0.414	RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3
5	P0C7P1	1.96e-38	153	496	0.107	0.230	RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens OX=9606 GN=RBMY1D PE=2 SV=1
6	A6NDE4	2.00e-38	153	496	0.107	0.230	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
7	A6NEQ0	2.00e-38	153	496	0.107	0.230	RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=1 SV=1
8	J3KPK3	2.41e-38	152	459	0.107	0.248	J3KPK3_HUMAN RNA binding motif protein Y-linked family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=4 SV=1
9	P0DJD3	3.18e-38	152	496	0.107	0.230	RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens OX=9606 GN=RBMY1A1 PE=1 SV=1
10	P0DJD4	3.33e-38	152	496	0.107	0.230	RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens OX=9606 GN=RBMY1C PE=1 SV=1
11	Q15415	6.74e-38	151	496	0.106	0.228	RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens OX=9606 GN=RBMY1F PE=1 SV=2
12	J3KQ82	7.33e-38	150	459	0.106	0.246	J3KQ82_HUMAN RNA binding motif protein Y-linked family 1 member F OS=Homo sapiens OX=9606 GN=RBMY1F PE=4 SV=1
13	O35698	7.57e-28	119	380	0.112	0.313	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
14	Q9DED4	6.23e-22	95.9	166	0.041	0.265	CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis OX=8355 GN=cirbp-b PE=1 SV=1
15	P60824	2.77e-21	94.4	172	0.042	0.262	CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus OX=10090 GN=Cirbp PE=1 SV=1
16	P60825	2.77e-21	94.4	172	0.042	0.262	CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Cirbp PE=2 SV=1
17	K7EPM4	5.45e-21	93.2	168	0.041	0.262	K7EPM4_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
18	Q14011	5.66e-21	93.6	172	0.041	0.256	CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
19	Q53XX5	5.66e-21	93.6	172	0.041	0.256	Q53XX5_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=2 SV=1
20	Q9PTX2	6.54e-21	92.8	164	0.039	0.256	CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeianus OX=8400 GN=cirbp PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05172 Nup35_RRM	5.3e+02	12.0	Nup53/35/40-type RNA recognition motif
2	PF00076 RRM_1	4.9e-17	72.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	4.8	18.7	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417451

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221494	0.709	Splicing factor 3A subunit 2
2	9606.ENSP00000307863	0.626	Splicing factor U2AF 65 kDa subunit
3	9606.ENSP00000342188	0.563	Leucine rich repeats and IQ motif containing 4
4	9606.ENSP00000430271	0.559	ETS translocation variant 3-like protein
5	9606.ENSP00000472998	0.557	U1 small nuclear ribonucleoprotein 70 kDa
6	9606.ENSP00000215793	0.555	Splicing factor 3A subunit 1
7	9606.ENSP00000335321	0.552	Splicing factor 3B subunit 1
8	9606.ENSP00000244520	0.551	U1 small nuclear ribonucleoprotein C
9	9606.ENSP00000266735	0.551	Small nuclear ribonucleoprotein F
10	9606.ENSP00000243563	0.550	U1 small nuclear ribonucleoprotein A
11	9606.ENSP00000246071	0.550	U2 small nuclear ribonucleoprotein B'
12	9606.ENSP00000252622	0.550	U6 snRNA-associated Sm-like protein LSm7
13	9606.ENSP00000292574	0.550	Coiled-coil domain containing 105
14	9606.ENSP00000293872	0.550	Putative RNA-binding protein Luc7-like 1
15	9606.ENSP00000347005	0.550	Putative RNA-binding protein Luc7-like 2
16	9606.ENSP00000425092	0.550	Luc7-like protein 3
17	9606.ENSP00000440222	0.550	Putative RNA-binding protein Luc7-like 2
18	9606.ENSP00000448073	0.550	Pre-mRNA-processing factor 40 homolog B
19	9606.ENSP00000304139	0.549	RNA binding motif protein, X-linked like 2
20	9606.ENSP00000215829	0.540	Small nuclear ribonucleoprotein Sm D3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.703	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.971	cellular process
GO:0071704	0.901	organic substance metabolic process
GO:0044238	0.897	primary metabolic process
GO:0044237	0.896	cellular metabolic process
GO:0006807	0.885	nitrogen compound metabolic process
GO:0043170	0.869	macromolecule metabolic process
GO:0034641	0.856	cellular nitrogen compound metabolic process
GO:0090304	0.849	nucleic acid metabolic process
GO:0016070	0.794	RNA metabolic process
GO:0010467	0.777	gene expression
GO:0016071	0.571	mRNA metabolic process
GO:0006396	0.559	RNA processing
GO:0065007	0.558	biological regulation
GO:0050789	0.551	regulation of biological process
GO:0050794	0.510	regulation of cellular process
GO:0008380	0.502	RNA splicing
GO:0006397	0.496	mRNA processing
GO:0000375	0.459	RNA splicing, via transesterification reactions
GO:0000377	0.449	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0000398	0.431	mRNA splicing, via spliceosome
GO:0016043	0.348	cellular component organization
GO:0019222	0.313	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.960	protein-containing complex
GO:0140513	0.866	nuclear protein-containing complex
GO:0005737	0.455	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]