StarFunc result for job id Q8N7Z5

User Input

>input (1873 residues)
MEEGVQAPDWDSDETVIEGSVTESDLEEKELPWRRLLFDQDASLKSEFSLHPDTRGMCKG
MPSPEIQLGFKLREDLQEQMNKNKMMPVLSEDTILQSQDETERNQALLQTRKNCSMFIGS
FRQSGLSLNHQNIEGPEAESPEVLPHIEKELSEGRDSPEVSLLSGTAITVSDTVAVKETS
LVEPEKILAAPNTFFEPRKEVTMTMTSEETKDEESSLETFVSALESLLTSPESTQEERLF
ELVSDFDRKELMNPLSDSLSSISIPLNSWSACHRDLLEDAKDDALPAELLEALNTLSEAK
VETICHRKEGGSSLIARNECLEVEFNTSQTNEDCTQIAETLQDPNPSGLQTLAHQNITSC
EPLSNKRNSNSVTNSSDQETACVLRRSSRLEKLKVSRDAKYSDHMYKMPEKILPKILGCE
DLTNNNSSAQNFRMQDPALMIDGKEKNMHSARFKNGKQIRKNEQFSGKKEKMKVNKISLH
SINRRNIFGENLVYKAALHDDADLVHHCIKKGGNVNQPSYAGWTALHEASVGGFYRTASE
LLKGGADVNIKGLYQITPLHDAVMNGHYKVAELLLLNGADPLFRNDDGKCALDEAKDLCM
KRLLERYIPKHQKCLTSAQRSSIDPLDIEDVYQHKKPKFSSKSHIWHVYNENSNRQKLEH
VKVNKGSKASLFINKEDVYEYYQKDPKNTKFGKSKHKQSTLDQIYSTGLRKGNLHNVKDP
NTNVPKGIGRRKTQHKRTQVDDVDCNPRKILAVSPSRRINRLVTYQQHIPETHNDLPEEL
CEPSSLTLSSLRNGLDSSTEACSVSKEKHIQNLDLSDSQEVQCLELESVDQTEAVSFPGL
LLHKEIKLPVVTTDKQPHTLQEQHHVLYKSHENSNLVPKDERFNKWENSFLSFVKENSDN
DDDDDCSTSEKAITSKKVLCSTGGKKHYNFKENLTNKKEMGFQQFLLSEDHLSQENELKA
VSLTTLPEQEAVNFSYSDNAVISEHVANYEQCIFGPSFDHSNGNPEQNSLACMRTLLTHE
ASKLTNHVELFKKPQDYIPRAPTFLMNQTDTHIVEKMAKNCDTERNYIDRDQKIIYSNEP
LSIVAHSQVIETTKVEKRRQNHLESETIHNIDSHSTDNMSKELANISKLSQREKKEISHK
PGMKAGRINKRNARGESQLHLAVRRGNLPLVKALIESGADVNLNDNAGWTPLHEASNEGS
IDIIVELLKAGAKVNCENIDGILPLHDAVANNHLKAAEILLQNGANPNQKDQKQKSALDE
ADDEKMKELLRSYGAIETVNRDESDAIVNEKIPAVRSKRHKQCFCDDGKTIDSSSLSHQE
RSRESLSVHQTLSAILQDIEEKQEYLLEFEIRNPEDAEQYIEKMLKIKKIMDNVLAKQKA
ERDDLAKKYRVSIESFKHGALREQLANLAARQKSLLVVAKKQKKISLKIQNCRNVTSLPC
LSLRKLPPRSEISSEKDSQELTSLENLEHPQSGSLSPVSGSMQETQLSLETWNYSQNTNI
CLNSEAVRRGEFSGNDMNSKQNGSDCTLDGFPKSRHSDGTEKNKLPSQPVAFIGQTEYSQ
KENDLTEATDKDHEFYVSSPVIGKLNISETASVLAENAAHPSNIICDQDLSNYDPKRGNR
KTSSQQSPTGASESLAHQGIAVLGSDTVHQMKPYLKKSVSVVPCADDSQISSSSGSGQQD
TIKKALNYSTAPKKKCIQIKDLILLGRINPGNNILEFKTQETTHKASILLNGKLKVESGQ
IYKNPVTWLKDLLGGNSYVTWNYAWSKVTYLGKELLRYVSEDAPILPEPNSVPQQYQPCL
PEVACLDDPVQEPNKSMFEKTKFGQGTSRESMQSSPRYLQINEILLISDQEFLPCHIMDQ
HWKFCVECEELTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140LI88	0.183	0.184	0.000	1857	0.547	0.551	A0A140LI88.pdb.gz	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
2	PDB:2dvwA	0.075	0.573	3.304E-8	229	0.029	0.236	2dvwA.pdb.gz
3	PDB:8cs9A	0.067	0.155	8.909E-7	796	0.022	0.052	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
4	PDB:7df7B	0.059	0.889	1.629E-6	119	0.019	0.303	7df7B.pdb.gz
5	PDB:3ehqA	0.059	0.598	1.787E-6	182	0.019	0.192	3ehqA.pdb.gz
6	PDB:6mwqA	0.073	0.264	2.842E-6	493	0.030	0.114	6mwqA.pdb.gz
7	PDB:1wg0A	0.065	0.487	4.960E-6	243	0.023	0.181	1wg0A.pdb.gz
8	AFDB:Q6UB98	0.071	0.065	5.856E-6	2062	0.138	0.125	Q6UB98.pdb.gz	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
9	PDB:6jd6B	0.070	0.625	1.042E-5	192	0.020	0.193	6jd6B.pdb.gz
10	PDB:4oauC	0.066	0.175	1.144E-5	692	0.023	0.064	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
11	PDB:1bd8A	0.066	0.743	1.658E-5	156	0.017	0.205	1bd8A.pdb.gz
12	PDB:1bu9A	0.068	0.695	1.905E-5	168	0.022	0.244	1bu9A.pdb.gz
13	AFDB:Q6UB99	0.072	0.051	2.356E-5	2663	0.127	0.089	Q6UB99.pdb.gz	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
14	AFDB:E9Q4F7	0.069	0.049	5.186E-5	2643	0.136	0.096	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
15	AFDB:Q0KHR2	0.082	0.080	5.960E-5	1918	0.125	0.122	Q0KHR2.pdb.gz	Q0KHR2_DROME Forked, isoform F OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
16	AFDB:D3ZRA6	0.047	0.051	6.243E-5	1683	0.132	0.147	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
17	AFDB:E9PYF4	0.042	0.044	6.540E-5	1699	0.109	0.121	E9PYF4.pdb.gz	E9PYF4_MOUSE LIM domain only 7 OS=Mus musculus OX=10090 GN=Lmo7 PE=1 SV=1
18	AFDB:Q5H9F3	0.065	0.070	1.733E-4	1711	0.111	0.121	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
19	AFDB:X2JEM2	0.046	0.041	3.318E-4	2326	0.121	0.098	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
20	AFDB:A0A0G2K8R3	0.040	0.041	3.995E-4	1729	0.123	0.134	A0A0G2K8R3.pdb.gz	A0A0G2K8R3_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140LI88	0.0	1785	1857	0.553	0.558	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
2	Q59GC3	7.40e-29	124	439	0.033	0.139	Q59GC3_HUMAN Ankyrin repeat domain 11 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
3	E9Q4F7	6.20e-28	126	2643	0.033	0.023	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
4	Q6UB99	1.82e-27	125	2663	0.033	0.023	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
5	Q6PG48	5.07e-26	113	330	0.028	0.161	Q6PG48_HUMAN ANKRD12 protein OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=1
6	Q6UB98	1.66e-24	115	2062	0.028	0.026	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
7	X5D778	3.10e-22	103	421	0.026	0.116	X5D778_HUMAN Ankyrin repeat domain 11 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=1
8	A0AVN2	7.16e-22	105	777	0.028	0.068	A0AVN2_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=1
9	Q99728	9.91e-22	105	777	0.028	0.068	BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
10	O70445	4.43e-20	99.8	765	0.028	0.068	BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus OX=10090 GN=Bard1 PE=2 SV=1
11	Q90X95	2.97e-19	97.1	772	0.027	0.066	Q90X95_XENLA BRCA1 associated RING domain 1 L homeolog OS=Xenopus laevis OX=8355 GN=bard1.L PE=1 SV=1
12	Q9QZH2	7.17e-19	95.9	768	0.026	0.064	BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus OX=10116 GN=Bard1 PE=2 SV=1
13	O75832	2.53e-17	85.1	226	0.026	0.217	PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10 PE=1 SV=1
14	Q96HA7	4.10e-17	90.9	1378	0.029	0.040	TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens OX=9606 GN=TONSL PE=1 SV=2
15	Q6TGV5	7.15e-17	84.0	226	0.022	0.186	Q6TGV5_DANRE 26S proteasome non-ATPase regulatory subunit 10 OS=Danio rerio OX=7955 GN=PSMD10 PE=1 SV=1
16	A0A2R8Y438	9.12e-17	89.4	944	0.026	0.051	A0A2R8Y438_HUMAN Ankyrin repeat domain containing 11 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=1
17	Q9Z2X2	1.03e-16	83.6	231	0.026	0.212	PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus OX=10090 GN=Psmd10 PE=1 SV=3
18	P40480	1.35e-16	89.0	1083	0.027	0.047	HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOS4 PE=1 SV=1
19	A0A087X2H0	1.47e-16	88.2	641	0.023	0.069	A0A087X2H0_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
20	Q9BQI6	3.77e-16	87.4	1058	0.027	0.048	SLF1_HUMAN SMC5-SMC6 complex localization factor protein 1 OS=Homo sapiens OX=9606 GN=SLF1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	6.4e-22	88.2	Ankyrin repeat
2	PF12796 Ank_2	1.7e-26	103.9	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.1e-20	82.3	Ankyrin repeat
4	PF13637 Ank_4	1.8e-18	77.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.1e-20	84.6	Ankyrin repeats (many copies)
6	PF18755 RAMA	2.4e-19	80.9	Restriction Enzyme Adenine Methylase Associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274361

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323782	0.630	Coiled-coil domain containing 43
2	9606.ENSP00000317027	0.626	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4
3	9606.ENSP00000355601	0.596	Egl nine homolog 1
4	9606.ENSP00000291560	0.557	Heat shock factor 2-binding protein
5	9606.ENSP00000386137	0.530	Olfactory receptor 2A14
6	9606.ENSP00000328423	0.520	Meiotic recombination protein REC114
7	9606.ENSP00000386452	0.518	Meiosis-specific coiled-coil domain-containing protein MEIOC
8	9606.ENSP00000366173	0.504	Chibby family member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0071704	0.983	organic substance metabolic process
GO:0050789	0.983	regulation of biological process
GO:0009987	0.982	cellular process
GO:0044238	0.982	primary metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:0050794	0.963	regulation of cellular process
GO:0044237	0.960	cellular metabolic process
GO:0043170	0.959	macromolecule metabolic process
GO:0048518	0.854	positive regulation of biological process
GO:0048522	0.826	positive regulation of cellular process
GO:0006725	0.770	cellular aromatic compound metabolic process
GO:0019222	0.740	regulation of metabolic process
GO:1901360	0.734	organic cyclic compound metabolic process
GO:0034641	0.733	cellular nitrogen compound metabolic process
GO:0046483	0.722	heterocycle metabolic process
GO:0060255	0.713	regulation of macromolecule metabolic process
GO:0090304	0.694	nucleic acid metabolic process
GO:0071840	0.661	cellular component organization or biogenesis
GO:0016043	0.650	cellular component organization
GO:0007127	0.509	meiosis I
GO:0044260	0.477	cellular macromolecule metabolic process
GO:0051171	0.463	regulation of nitrogen compound metabolic process
GO:0080090	0.456	regulation of primary metabolic process
GO:0051726	0.446	regulation of cell cycle
GO:0007059	0.416	chromosome segregation
GO:0051276	0.397	chromosome organization
GO:0010604	0.346	positive regulation of macromolecule metabolic process
GO:0031323	0.317	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0043232	0.895	intracellular non-membrane-bounded organelle
GO:0005634	0.870	nucleus
GO:0005737	0.856	cytoplasm
GO:0005694	0.806	chromosome
GO:0070013	0.592	intracellular organelle lumen
GO:0031981	0.569	nuclear lumen
GO:0005654	0.560	nucleoplasm
GO:0016020	0.492	membrane
GO:0005829	0.382	cytosol
GO:0000785	0.378	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]