StarFunc result for job id Q8N819

User Input

>input (430 residues)
MAVLARQLQRLLWTACKKKEREKEGREEEEEEEAGRRAPEGPRSLLTAPRRAQRPHGGAE
ASGGLRFGASAAQGWRARMEDAHCTWLSLPGLPPGWALFAVLDGHGGARAARFGARHLPG
HVLQELGPEPSEPEGVREALRRAFLSADERLRSLWPRVETGGCTAVVLLVSPRFLYLAHC
GDSRAVLSRAGAVAFSTEDHRPLRPRERERIHAAGGTIRRRRVEGSLAVSRALGDFTYKE
APGRPPELQLVSAEPEVAALARQAEDEFMLLASDGVWDTVSGAALAGLVASRLRLGLAPE
LLCAQLLDTCLCKGSLDNMTCILVCFPGAPRPSEEAIRRELALDAALGCRIAELCASAQK
PPSLNTVFRTLASEDIPDLPPGGGLDCKATVIAEVYSQICQVSEECGEKGQDGAGKSNPT
HLGSALDMEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75688	0.796	0.716	9.773E-44	479	0.405	0.363	O75688.pdb.gz	PPM1B_HUMAN Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1
2	AFDB:Q5U386	0.800	0.899	3.046E-43	382	0.407	0.458	Q5U386.pdb.gz	Q5U386_DANRE Protein phosphatase 1A, magnesium dependent, alpha OS=Danio rerio OX=7955 GN=ppm1a PE=1 SV=1
3	AFDB:A0A024R6A5	0.800	0.899	4.092E-42	382	0.386	0.435	A0A024R6A5.pdb.gz
4	PDB:1a6qA	0.782	0.924	1.429E-40	363	0.379	0.449	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
5	AFDB:Q961C5	0.775	0.888	8.690E-40	374	0.330	0.380	Q961C5.pdb.gz	Q961C5_DROME Alphabet, isoform E OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
6	AFDB:Q09172	0.599	0.692	2.445E-30	370	0.288	0.335	Q09172.pdb.gz	PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc2 PE=3 SV=1
7	AFDB:P49596	0.610	0.733	4.942E-30	356	0.265	0.320	P49596.pdb.gz	PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans OX=6239 GN=ppm-2 PE=3 SV=2
8	AFDB:A0A1D8PRZ8	0.617	0.458	8.451E-28	583	0.258	0.190	A0A1D8PRZ8.pdb.gz	A0A1D8PRZ8_CANAL Type 2C protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PTC2 PE=3 SV=1
9	AFDB:O81716	0.592	0.715	9.418E-28	355	0.247	0.299	O81716.pdb.gz	P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana OX=3702 GN=PPC4-2 PE=1 SV=1
10	AFDB:Q586U3	0.614	0.822	1.376E-27	319	0.260	0.351	Q586U3.pdb.gz	Q586U3_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.55 PE=4 SV=1
11	AFDB:Q09173	0.609	0.632	1.533E-27	414	0.235	0.244	Q09173.pdb.gz	PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc3 PE=3 SV=1
12	PDB:4oicB	0.525	0.732	2.536E-19	305	0.214	0.302	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
13	PDB:4jndA	0.531	0.558	7.451E-17	408	0.177	0.186	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
14	PDB:5nzzD	0.501	0.563	1.306E-13	379	0.149	0.169	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
15	PDB:7kprA	0.477	0.506	2.640E-13	403	0.160	0.171	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
16	PDB:2pk0A	0.408	0.675	4.277E-11	247	0.121	0.211	2pk0A.pdb.gz	Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
17	PDB:5d2uA	0.407	0.696	3.934E-10	240	0.135	0.242	5d2uA.pdb.gz	Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition
18	PDB:6jkvA	0.430	0.761	1.938E-8	230	0.156	0.291	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
19	PDB:3w40A	0.355	0.692	3.898E-6	199	0.091	0.196	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
20	PDB:6rreD	0.318	0.320	1.585E-3	427	0.112	0.112	6rreD.pdb.gz	Structural insight into the membrane targeting domain of the Legionella deAMPylase SidD.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5U386	9.66e-109	327	382	0.409	0.461	Q5U386_DANRE Protein phosphatase 1A, magnesium dependent, alpha OS=Danio rerio OX=7955 GN=ppm1a PE=1 SV=1
2	C9JIR6	1.30e-104	317	378	0.384	0.437	C9JIR6_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1
3	O75688	5.05e-104	318	479	0.384	0.344	PPM1B_HUMAN Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1
4	P36993	7.65e-104	315	390	0.391	0.431	PPM1B_MOUSE Protein phosphatase 1B OS=Mus musculus OX=10090 GN=Ppm1b PE=1 SV=1
5	P35813	1.41e-101	309	382	0.377	0.424	PPM1A_HUMAN Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1
6	P20650	2.74e-100	306	382	0.374	0.421	PPM1A_RAT Protein phosphatase 1A OS=Rattus norvegicus OX=10116 GN=Ppm1a PE=1 SV=1
7	P49443	5.59e-100	305	382	0.374	0.421	PPM1A_MOUSE Protein phosphatase 1A OS=Mus musculus OX=10090 GN=Ppm1a PE=1 SV=1
8	Q8IMK7	3.51e-82	259	371	0.337	0.391	Q8IMK7_DROME Alphabet, isoform B OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
9	Q9VAK1	4.77e-82	258	368	0.337	0.394	Q9VAK1_DROME Alphabet, isoform A OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
10	Q961C5	8.14e-82	258	374	0.337	0.388	Q961C5_DROME Alphabet, isoform E OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
11	A0A0B4K7Q3	4.59e-76	242	332	0.300	0.389	A0A0B4K7Q3_DROME Alphabet, isoform F OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
12	Q09172	7.48e-55	188	370	0.267	0.311	PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc2 PE=3 SV=1
13	O81716	8.23e-52	179	355	0.256	0.310	P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana OX=3702 GN=PPC4-2 PE=1 SV=1
14	P49596	1.11e-51	179	356	0.249	0.301	PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans OX=6239 GN=ppm-2 PE=3 SV=2
15	Q586U3	7.51e-51	176	319	0.247	0.332	Q586U3_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.55 PE=4 SV=1
16	Q381U4	5.88e-48	171	429	0.240	0.240	Q381U4_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6540 PE=4 SV=1
17	Q38BA8	1.95e-47	166	293	0.242	0.355	Q38BA8_TRYB2 Protein phosphatase 2C-like, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2270 PE=4 SV=1
18	Q4WTH5	7.96e-47	168	429	0.235	0.235	Q4WTH5_ASPFU Protein phosphatase 2C, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G09280 PE=3 SV=1
19	Q9SZ53	9.72e-47	166	357	0.263	0.317	P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana OX=3702 GN=At4g31860 PE=2 SV=1
20	Q09173	1.41e-44	162	414	0.230	0.239	PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00481 PP2C	1.9e-59	213.0	Protein phosphatase 2C
2	PF13672 PP2C_2	0.00014	33.2	Protein phosphatase 2C
3	PF07830 PP2C_C	2.4e-23	93.7	Protein serine/threonine phosphatase 2C, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000397050

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346255	0.557	Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q . Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation
2	9606.ENSP00000329920	0.556	Mast cell expressed membrane protein 1
3	9606.ENSP00000438264	0.547	Leucine rich repeat, Ig-like and transmembrane domains 2
4	9606.ENSP00000211314	0.535	Transmembrane protein 14A
5	9606.ENSP00000229955	0.521	Probable G-protein coupled receptor 63
6	9606.ENSP00000386022	0.517	Membrane-spanning 4-domains subfamily A member 15
7	9606.ENSP00000465099	0.501	DNA-directed RNA polymerase I subunit RPA34

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006470	0.997	protein dephosphorylation
GO:0050789	0.977	regulation of biological process
GO:0050794	0.766	regulation of cellular process
GO:0019222	0.310	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0005829	0.950	cytosol
GO:0005634	0.894	nucleus
GO:0016020	0.674	membrane
GO:0043233	0.385	organelle lumen
GO:0070013	0.378	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]