StarFunc result for job id Q8N884

User Input

>input (522 residues)
MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAGKFGPARKSGSR
QKKSAPDTQERPPVRATGARAKKAPQRAQDTQPSDATSAPGAEGLEPPAAREPALSRAGS
CRQRGARCSTKPRPPPGPWDVPSPGLPVSAPILVRRDAAPGASKLRAVLEKLKLSRDDIS
TAAGMVKGVVDHLLLRLKCDSAFRGVGLLNTGSYYEHVKISAPNEFDVMFKLEVPRIQLE
EYSNTRAYYFVKFKRNPKENPLSQFLEGEILSASKMLSKFRKIIKEEINDIKDTDVIMKR
KRGGSPAVTLLISEKISVDITLALESKSSWPASTQEGLRIQNWLSAKVRKQLRLKPFYLV
PKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQL
KERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKL
ENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N884	1.000	1.000	4.604E-84	522	1.000	1.000	Q8N884.pdb.gz	CGAS_HUMAN Cyclic GMP-AMP synthase OS=Homo sapiens OX=9606 GN=CGAS PE=1 SV=2
2	PDB:7buqA	0.657	0.939	2.825E-43	362	0.477	0.688	7buqA.pdb.gz	Mn2+Directly Activates cGAS and Structural Analysis Suggests Mn2+Induces a Noncanonical Catalytic Synthesis of 2'3'-cGAMP.
3	PDB:7lt2A	0.500	0.652	2.531E-16	387	0.155	0.209	7lt2A.pdb.gz	cGAS-like receptors sense RNA and control 3'2'-cGAMP signalling in Drosophila.
4	PDB:5eomC	0.492	0.700	2.556E-15	353	0.144	0.212	5eomC.pdb.gz	Structural and biochemical characterization of the cell fate determining nucleotidyltransferase fold protein MAB21L1.
5	PDB:5eogF	0.442	0.658	7.070E-13	330	0.144	0.227	5eogF.pdb.gz
6	PDB:7lt1A	0.510	0.642	2.772E-12	403	0.117	0.151	7lt1A.pdb.gz
7	PDB:5eomJ	0.384	0.655	3.710E-9	286	0.130	0.238	5eomJ.pdb.gz	Structural and biochemical characterization of the cell fate determining nucleotidyltransferase fold protein MAB21L1.
8	PDB:6e0nA	0.397	0.699	2.122E-7	271	0.063	0.122	6e0nA.pdb.gz	Bacterial cGAS-like enzymes synthesize diverse nucleotide signals.
9	PDB:4rwnA	0.367	0.523	5.013E-5	349	0.090	0.135	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
10	PDB:4atbA	0.319	0.465	5.283E-5	334	0.069	0.108	4atbA.pdb.gz	NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
11	PDB:4xj6A	0.383	0.514	6.871E-5	370	0.082	0.116	4xj6A.pdb.gz	Structural Basis for the Catalytic Mechanism of DncV, Bacterial Homolog of Cyclic GMP-AMP Synthase
12	AFDB:A0A0X1KG68	0.276	0.191	6.166E-4	792	0.134	0.088	A0A0X1KG68.pdb.gz
13	AFDB:E9PKY2	0.360	0.168	5.604E-3	1203	0.119	0.052	E9PKY2.pdb.gz	E9PKY2_HUMAN RNA uridylyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=1
14	AFDB:O13657	0.098	0.074	9.661E-1	803	0.140	0.091	O13657.pdb.gz	YBCC_SCHPO Putative metal ion transporter C27B12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi066 PE=1 SV=1
15	AFDB:P48380	0.087	0.068	9.661E-1	749	0.102	0.071	P48380.pdb.gz	RFX3_HUMAN Transcription factor RFX3 OS=Homo sapiens OX=9606 GN=RFX3 PE=1 SV=2
16	AFDB:Q17336	0.107	0.071	4.208	897	0.115	0.067	Q17336.pdb.gz	CWC22_CAEEL Pre-mRNA-splicing factor CWC22 homolog OS=Caenorhabditis elegans OX=6239 GN=let-858 PE=2 SV=1
17	AFDB:A0A1D8PD58	0.102	0.096	4.674	563	0.107	0.099	A0A1D8PD58.pdb.gz	A0A1D8PD58_CANAL Globin family profile domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C103870CA PE=3 SV=1
18	AFDB:Q5A6T5	0.080	0.073	5.192	589	0.115	0.102	Q5A6T5.pdb.gz	STE7_CANAL Serine/threonine-protein kinase STE7 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HST7 PE=3 SV=2
19	AFDB:Q9HBL0	0.065	0.029	5.472	1735	0.105	0.032	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
20	AFDB:Q63ZY3	0.065	0.046	6.078	851	0.073	0.045	Q63ZY3.pdb.gz	KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C6L5	0.0	541	507	0.577	0.594	CGAS_MOUSE Cyclic GMP-AMP synthase OS=Mus musculus OX=10090 GN=Cgas PE=1 SV=1
2	Q8N884	0.0	1079	522	1.000	1.000	CGAS_HUMAN Cyclic GMP-AMP synthase OS=Homo sapiens OX=9606 GN=CGAS PE=1 SV=2
3	F1QCP4	4.25e-83	271	592	0.335	0.296	F1QCP4_DANRE Cyclic GMP-AMP synthase OS=Danio rerio OX=7955 GN=mb21d1 PE=3 SV=2
4	Q8UUZ1	8.21e-16	81.3	359	0.130	0.189	MB212_DANRE Protein mab-21-like 2 OS=Danio rerio OX=7955 GN=mab21l2 PE=1 SV=1
5	Q9Y586	5.57e-14	75.9	359	0.125	0.181	MB212_HUMAN Protein mab-21-like 2 OS=Homo sapiens OX=9606 GN=MAB21L2 PE=1 SV=1
6	Q8BPP1	5.82e-14	75.5	359	0.125	0.181	MB212_MOUSE Protein mab-21-like 2 OS=Mus musculus OX=10090 GN=Mab21l2 PE=2 SV=1
7	A7SFB5	1.25e-13	75.1	422	0.167	0.206	CGAS_NEMVE Cyclic GMP-AMP synthase OS=Nematostella vectensis OX=45351 GN=v1g211400 PE=1 SV=1
8	O70299	3.07e-13	73.6	359	0.126	0.184	MB211_MOUSE Putative nucleotidyltransferase MAB21L1 OS=Mus musculus OX=10090 GN=Mab21l1 PE=2 SV=1
9	Q13394	3.07e-13	73.6	359	0.126	0.184	MB211_HUMAN Putative nucleotidyltransferase MAB21L1 OS=Homo sapiens OX=9606 GN=MAB21L1 PE=1 SV=1
10	Q9Y106	1.84e-12	71.2	368	0.125	0.177	MB21L_DROME Protein mab-21-like OS=Drosophila melanogaster OX=7227 GN=CG4766 PE=1 SV=1
11	Q8N8X9	3.87e-10	63.9	362	0.167	0.240	MB213_HUMAN Protein mab-21-like 3 OS=Homo sapiens OX=9606 GN=MAB21L3 PE=1 SV=2
12	Q9VSH0	1.07e-07	56.2	346	0.161	0.243	CGASL_DROME Cyclic GMP-AMP synthase-like protein OS=Drosophila melanogaster OX=7227 GN=CG7194 PE=1 SV=1
13	D6WI29	5.77e-07	54.3	398	0.146	0.191	CGLR_TRICA Cyclic GMP-AMP synthase-like receptor OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC003965 PE=1 SV=1
14	Q8IYB1	1.36e-04	47.0	491	0.094	0.100	M21D2_HUMAN Nucleotidyltransferase MB21D2 OS=Homo sapiens OX=9606 GN=MB21D2 PE=1 SV=3
15	Q20054	0.001	43.5	364	0.100	0.143	MAB21_CAEEL Protein male abnormal 21 OS=Caenorhabditis elegans OX=6239 GN=mab-21 PE=2 SV=2
16	P0DV11	0.004	42.0	372	0.148	0.207	CGLR_DROEU Cyclic GMP-AMP synthase-like receptor OS=Drosophila eugracilis OX=29029 PE=3 SV=1
17	Q8IWB1	0.039	38.9	547	0.065	0.062	IPRI_HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Homo sapiens OX=9606 GN=ITPRIP PE=1 SV=1
18	Q3TNL8	0.070	38.1	555	0.067	0.063	IPRI_MOUSE Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Mus musculus OX=10090 GN=Itprip PE=1 SV=1
19	Q7Z5P9	0.37	36.2	8384	0.075	0.005	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3
20	Q80TJ5	0.66	35.4	1736	0.052	0.016	Q80TJ5_MOUSE MKIAA1114 protein (Fragment) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03281 Mab-21	3.2e-41	153.2	Mab-21 protein nucleotidyltransferase domain
2	PF20266 Mab-21_C	7.8e-23	91.8	Mab-21 protein HhH/H2TH-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359339

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331288	0.994	Stimulator of interferon genes protein
2	9606.ENSP00000355231	0.988	Beclin-1
3	9606.ENSP00000357113	0.986	Gamma-interferon-inducible protein 16
4	9606.ENSP00000329967	0.907	Serine/threonine-protein kinase TBK1
5	9606.ENSP00000218224	0.898	Polyglutamine-binding protein 1
6	9606.ENSP00000471896	0.856	Interferon regulatory factor 3
7	9606.ENSP00000422753	0.843	Probable ATP-dependent RNA helicase DDX41
8	9606.ENSP00000358155	0.841	Histone cluster 2 H2A family member a4
9	9606.ENSP00000475814	0.841	Histone H2A type 2-A
10	9606.ENSP00000333277	0.835	Histone cluster 2 H3 family member d
11	9606.ENSP00000358154	0.835	Histone cluster 2 H3 family member c
12	9606.ENSP00000385479	0.835	Histone H3.2
13	9606.ENSP00000303373	0.828	Histone cluster 1 H2A family member e
14	9606.ENSP00000483842	0.828	Histone H2A type 1-B/E
15	9606.ENSP00000332194	0.826	Histone H2A type 2-C
16	9606.ENSP00000244537	0.817	Histone cluster 1 H4 family member f
17	9606.ENSP00000347168	0.817	Histone cluster 1 H4 family member j
18	9606.ENSP00000366956	0.817	Histone cluster 1 H4 family member h
19	9606.ENSP00000366974	0.817	Histone cluster 1 H4 family member b
20	9606.ENSP00000367034	0.817	Histone cluster 1 H4 family member c

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031491	1.000	nucleosome binding
GO:0042803	1.000	protein homodimerization activity
GO:0061501	1.000	2',3'-cyclic GMP-AMP synthase activity
GO:0003690	1.000	double-stranded DNA binding
GO:0005546	0.966	phosphatidylinositol-4,5-bisphosphate binding
GO:0060090	0.965	molecular adaptor activity
GO:0140693	0.952	molecular condensate scaffold activity
GO:0003723	0.508	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.999	regulation of cellular process
GO:0050896	0.998	response to stimulus
GO:0006950	0.994	response to stress
GO:0051716	0.993	cellular response to stimulus
GO:0048583	0.992	regulation of response to stimulus
GO:0051707	0.990	response to other organism
GO:0001817	0.986	regulation of cytokine production
GO:0051240	0.985	positive regulation of multicellular organismal process
GO:0019219	0.985	regulation of nucleobase-containing compound metabolic process
GO:0010628	0.985	positive regulation of gene expression
GO:0007165	0.983	signal transduction
GO:0032481	0.981	positive regulation of type I interferon production
GO:0009615	0.980	response to virus
GO:0050688	0.978	regulation of defense response to virus
GO:0140546	0.977	defense response to symbiont
GO:0002253	0.977	activation of immune response
GO:0045089	0.976	positive regulation of innate immune response
GO:0002230	0.971	positive regulation of defense response to virus by host
GO:0048519	0.968	negative regulation of biological process
GO:0051607	0.966	defense response to virus
GO:0002218	0.963	activation of innate immune response
GO:0035556	0.952	intracellular signal transduction
GO:0048523	0.946	negative regulation of cellular process
GO:0010605	0.924	negative regulation of macromolecule metabolic process
GO:0006282	0.912	regulation of DNA repair
GO:0010569	0.894	regulation of double-strand break repair via homologous recombination
GO:0048585	0.885	negative regulation of response to stimulus
GO:0019935	0.885	cyclic-nucleotide-mediated signaling
GO:0019933	0.882	cAMP-mediated signaling
GO:0045934	0.867	negative regulation of nucleobase-containing compound metabolic process
GO:0045910	0.789	negative regulation of DNA recombination
GO:2001021	0.786	negative regulation of response to DNA damage stimulus
GO:0048522	0.686	positive regulation of cellular process
GO:0010033	0.420	response to organic substance
GO:0033554	0.412	cellular response to stress
GO:0007267	0.371	cell-cell signaling
GO:0031325	0.366	positive regulation of cellular metabolic process
GO:0070887	0.363	cellular response to chemical stimulus
GO:0006974	0.354	cellular response to DNA damage stimulus
GO:0051252	0.351	regulation of RNA metabolic process
GO:0006955	0.345	immune response
GO:0051173	0.344	positive regulation of nitrogen compound metabolic process
GO:0019934	0.306	cGMP-mediated signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.999	plasma membrane
GO:0005654	0.999	nucleoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005694	0.861	chromosome
GO:0090734	0.558	site of DNA damage
GO:0035861	0.459	site of double-strand break

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:42064	1.000	ATP + GTP = 2',3'-cGAMP + 2 diphosphate
EC:2.7.7.86	1.000	cyclic GMP-AMP synthase.

[back to server]