StarFunc result for job id Q8N895

User Input

>input (744 residues)
MQKEMKMIKDEDVHFDLAVKKTPSFPHCLQPVASRGKAPQRHPFPEALRGPFSQFRYEPP
PGDLDGFPGVFEGAGSRKRKSMPTKMPYNHPAEEVTLALHSEENKNHGLPNLPLLFPQPP
RPKYDSQMIDLCNVGFQFYRSLEHFGGKPVKQEPIKPSAVWPQPTPTPFLPTPYPYYPKV
HPGLMFPFFVPSSSPFPFSRHTFLPKQPPEPLLPRKAEPQESEETKQKVERVDVNVQIDD
SYYVDVGGSQKRWQCPTCEKSYTSKYNLVTHILGHSGIKPHACTHCGKLFKQLSHLHTHM
LTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCGRGFAYPSELKAHEAKHA
SGRENICVECGLDFPTLAQLKRHLTTHRGPIQYNCSECDKTFQYPSQLQNHMMKHKDIRP
YICSECGMEFVQPHHLKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCH
LCYKSFVQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHMHLHSDSKPFKCLYCPS
KFTLKGNLTRHMKVKHGVMERGLHSQGLGRGRIALAQTAGVLRSLEQEEPFDLSQKRRAK
VPVFQSDGESAQGSHCHEEEEEDNCYEVEPYSPGLAPQSQQLCTPEDLSTKSEHAPEVLE
EACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYF
KHRDESLKELLERKMEKQAVLLGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N895	1.000	1.000	0.000	744	1.000	1.000	Q8N895.pdb.gz	ZN366_HUMAN Zinc finger protein 366 OS=Homo sapiens OX=9606 GN=ZNF366 PE=1 SV=1
2	AFDB:Q6NS86	0.519	0.518	1.037E-100	746	0.858	0.855	Q6NS86.pdb.gz	ZN366_MOUSE Zinc finger protein 366 OS=Mus musculus OX=10090 GN=Znf366 PE=2 SV=1
3	AFDB:Q96MU6	0.250	0.255	1.430E-30	729	0.184	0.188	Q96MU6.pdb.gz	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
4	AFDB:Q15935	0.247	0.331	1.517E-30	545	0.152	0.207	Q15935.pdb.gz	ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens OX=9606 GN=ZNF77 PE=1 SV=2
5	AFDB:Q8TC21	0.250	0.361	2.167E-30	504	0.151	0.222	Q8TC21.pdb.gz	ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens OX=9606 GN=ZNF596 PE=1 SV=2
6	AFDB:Q15937	0.249	0.363	1.839E-29	498	0.184	0.275	Q15937.pdb.gz	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
7	AFDB:P17020	0.224	0.242	2.071E-29	682	0.187	0.204	P17020.pdb.gz	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
8	AFDB:E9Q981	0.244	0.283	2.787E-29	636	0.148	0.173	E9Q981.pdb.gz	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
9	AFDB:Q96NL3	0.244	0.302	2.957E-29	588	0.164	0.207	Q96NL3.pdb.gz	ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens OX=9606 GN=ZNF599 PE=1 SV=1
10	AFDB:Q8NEP9	0.154	0.179	3.138E-29	628	0.180	0.213	Q8NEP9.pdb.gz	ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens OX=9606 GN=ZNF555 PE=1 SV=4
11	PDB:3w5kB	0.062	0.288	2.578E-4	110	0.043	0.291	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6f40P	0.048	0.092	8.195E-2	246	0.047	0.142	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
13	PDB:6o9lQ	0.053	0.076	2.688E-1	430	0.056	0.098	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
14	PDB:5dkaA	0.043	0.261	3.213E-1	96	0.026	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:6ydhA	0.030	0.218	3.213E-1	62	0.015	0.177	6ydhA.pdb.gz
16	PDB:5apny	0.041	0.111	1.187	211	0.034	0.118	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
17	PDB:5xbtA	0.044	0.087	1.187	271	0.032	0.089	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
18	PDB:4c2mI	0.027	0.123	1.337	124	0.027	0.161	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
19	PDB:7o4iW	0.038	0.076	1.337	312	0.047	0.112	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
20	PDB:7kpvC	0.068	0.086	1.418	487	0.075	0.115	7kpvC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NS86	0.0	1292	746	0.856	0.854	ZN366_MOUSE Zinc finger protein 366 OS=Mus musculus OX=10090 GN=Znf366 PE=2 SV=1
2	Q8N1W2	0.0	579	664	0.387	0.434	ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens OX=9606 GN=ZNF710 PE=1 SV=2
3	Q8N895	0.0	1540	744	1.000	1.000	ZN366_HUMAN Zinc finger protein 366 OS=Homo sapiens OX=9606 GN=ZNF366 PE=1 SV=1
4	Q9NQZ8	5.25e-65	226	489	0.156	0.237	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
5	Q9C0F3	1.68e-64	224	470	0.149	0.236	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
6	P15622	8.78e-64	224	560	0.161	0.214	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
7	F8WEZ9	7.88e-63	220	492	0.168	0.254	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
8	Q8WV37	8.14e-63	221	535	0.168	0.234	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
9	O43296	1.23e-62	223	627	0.155	0.183	ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens OX=9606 GN=ZNF264 PE=1 SV=1
10	P51523	1.52e-62	225	738	0.169	0.171	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
11	Q14C61	1.59e-62	223	627	0.155	0.183	Q14C61_HUMAN ZNF264 protein OS=Homo sapiens OX=9606 GN=ZNF264 PE=1 SV=1
12	O75437	3.18e-62	222	659	0.156	0.176	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
13	Q9Y2P0	3.45e-62	219	537	0.164	0.227	ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens OX=9606 GN=ZNF835 PE=1 SV=2
14	Q08ER8	3.51e-62	221	600	0.152	0.188	ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens OX=9606 GN=ZNF543 PE=1 SV=3
15	Q96HQ0	3.77e-62	219	510	0.159	0.231	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
16	Q8TC21	1.18e-61	217	504	0.151	0.222	ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens OX=9606 GN=ZNF596 PE=1 SV=2
17	A6NNF4	1.56e-61	219	616	0.156	0.188	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
18	Q8NDQ6	1.79e-61	220	660	0.151	0.170	ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens OX=9606 GN=ZNF540 PE=1 SV=1
19	Q15935	2.45e-61	217	545	0.155	0.211	ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens OX=9606 GN=ZNF77 PE=1 SV=2
20	Q8TBZ8	2.68e-61	217	553	0.141	0.190	ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens OX=9606 GN=ZNF564 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01155 HypA	23	16.4	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
2	PF00096 zf-C2H2	2.6e-42	152.1	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	8.2	17.6	zinc-finger C2H2-type
4	PF12756 zf-C2H2_2	39	16.0	C2H2 type zinc-finger (2 copies)
5	PF18868 zf-C2H2_3rep	46	16.1	Zinc finger C2H2-type, 3 repeats
6	PF13894 zf-C2H2_4	3e-30	113.3	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	8.8e-09	46.4	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	2.9e-05	35.5	Zinc-finger double-stranded RNA-binding
9	PF16278 zf-C2HE	1.2e+02	14.5	C2HE / C2H2 / C2HC zinc-binding finger
10	PF13465 zf-H2C2_2	3e-36	133.4	Zinc-finger double domain
11	PF12874 zf-met	51	15.7	Zinc-finger of C2H2 type
12	PF17283 Zn_ribbon_SprT	9.9e+02	11.2	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313158

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290921	0.896	C-terminal-binding protein 1
2	9606.ENSP00000364405	0.765	Zinc finger protein 367
3	9606.ENSP00000217173	0.720	RING finger protein 37
4	9606.ENSP00000253270	0.716	UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter
5	9606.ENSP00000327323	0.712	Threonine synthase-like 2
6	9606.ENSP00000359172	0.704	UDP-N-acetylglucosamine transporter
7	9606.ENSP00000369756	0.682	Receptor-type tyrosine-protein phosphatase alpha
8	9606.ENSP00000305334	0.639	Follistatin-related protein 5
9	9606.ENSP00000379621	0.639	Sorting nexin-16
10	9606.ENSP00000353496	0.618	Leucine zipper putative tumor suppressor 3
11	9606.ENSP00000394484	0.602	Serine/threonine-protein kinase DCLK3
12	9606.ENSP00000383063	0.590	Nuclear receptor-interacting protein 1
13	9606.ENSP00000307260	0.571	Transducin beta-like protein 2
14	9606.ENSP00000364382	0.569	Thioredoxin-like protein AAED1
15	9606.ENSP00000359778	0.567	Adhesion G protein-coupled receptor L4
16	9606.ENSP00000393453	0.544	Histone-lysine N-methyltransferase SMYD1
17	9606.ENSP00000307684	0.509	Transcriptional adapter 3
18	9606.ENSP00000295834	0.505	Fatty acid-binding protein, liver

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140110	0.998	transcription regulator activity
GO:0008134	0.998	transcription factor binding
GO:0140297	0.990	DNA-binding transcription factor binding
GO:0003712	0.978	transcription coregulator activity
GO:0061629	0.875	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.862	nuclear receptor binding
GO:0003714	0.844	transcription corepressor activity
GO:0030331	0.832	nuclear estrogen receptor binding
GO:0097159	0.741	organic cyclic compound binding
GO:1901363	0.740	heterocyclic compound binding
GO:0003676	0.645	nucleic acid binding
GO:0003677	0.326	DNA binding
GO:0000976	0.324	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.986	regulation of metabolic process
GO:0060255	0.965	regulation of macromolecule metabolic process
GO:0051171	0.960	regulation of nitrogen compound metabolic process
GO:0080090	0.959	regulation of primary metabolic process
GO:0010468	0.928	regulation of gene expression
GO:0031323	0.921	regulation of cellular metabolic process
GO:0009987	0.909	cellular process
GO:1903506	0.896	regulation of nucleic acid-templated transcription
GO:0006355	0.890	regulation of DNA-templated transcription
GO:0048523	0.887	negative regulation of cellular process
GO:0051172	0.864	negative regulation of nitrogen compound metabolic process
GO:0010605	0.863	negative regulation of macromolecule metabolic process
GO:0045892	0.848	negative regulation of DNA-templated transcription
GO:0050896	0.846	response to stimulus
GO:0010646	0.766	regulation of cell communication
GO:0006357	0.766	regulation of transcription by RNA polymerase II
GO:0023051	0.763	regulation of signaling
GO:0042221	0.707	response to chemical
GO:0048583	0.687	regulation of response to stimulus
GO:0009966	0.683	regulation of signal transduction
GO:0033143	0.658	regulation of intracellular steroid hormone receptor signaling pathway
GO:0010033	0.640	response to organic substance
GO:0000122	0.622	negative regulation of transcription by RNA polymerase II
GO:0048518	0.381	positive regulation of biological process
GO:0051716	0.361	cellular response to stimulus
GO:0048522	0.350	positive regulation of cellular process
GO:0009719	0.328	response to endogenous stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0016020	0.862	membrane
GO:0005737	0.739	cytoplasm
GO:0071944	0.720	cell periphery
GO:0005886	0.657	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]