StarFunc result for job id Q8N8A2

User Input

>input (993 residues)
MAVLKLTDQPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELL
ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAV
KCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWA
AYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGN
TALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVN
IQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLIT
SGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVEC
IKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAA
SDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAA
AYGHRQCLELLLERTNSGFEESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKG
RTALDLAAFKGHTECVEALINQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLEIADNP
EAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVDILGCTALHRGIMTGHEECVQ
MLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDNQGYTPLHWAC
YNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDKGR
TPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLT
VKDKDLNTPLHLACSKGHEKCALLILDKIQDESLINEKNNALQTPLHVAARNGLKVVVEE
LLAKGACVLAVDENASRSNGPRSTPGTAVQKEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N8A2	1.000	1.000	0.000	993	1.000	1.000	Q8N8A2.pdb.gz	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
2	AFDB:O15084	0.865	0.819	1.341E-93	1053	0.688	0.649	O15084.pdb.gz	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
3	AFDB:Q8NB46	0.707	0.657	7.626E-89	1076	0.622	0.574	Q8NB46.pdb.gz	ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3
4	AFDB:Q9VMR4	0.655	0.392	1.359E-43	1761	0.270	0.152	Q9VMR4.pdb.gz	Q9VMR4_DROME No mechanoreceptor potential C, isoform H OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=4
5	AFDB:A0A0G2K916	0.574	0.240	2.175E-41	2615	0.264	0.100	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
6	AFDB:P16157	0.454	0.280	4.492E-41	1881	0.268	0.141	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
7	AFDB:Q9NCP8	0.379	0.331	8.023E-41	1159	0.250	0.214	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
8	AFDB:O70511	0.383	0.166	9.973E-41	2622	0.249	0.094	O70511.pdb.gz	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
9	AFDB:O75179	0.558	0.234	1.034E-40	2603	0.271	0.103	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
10	AFDB:E9QEX9	0.578	0.244	1.382E-40	2607	0.272	0.104	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
11	PDB:8cs9A	0.405	0.492	4.337E-39	796	0.243	0.303	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:5vkqA	0.543	0.382	2.906E-35	1499	0.257	0.170	5vkqA.pdb.gz
13	PDB:4oauC	0.239	0.328	7.793E-12	692	0.095	0.136	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.206	0.842	1.203E-9	229	0.067	0.293	2dvwA.pdb.gz
15	PDB:6aunA	0.221	0.331	2.622E-8	618	0.098	0.157	6aunA.pdb.gz
16	PDB:1wg0A	0.200	0.784	7.502E-8	243	0.058	0.239	1wg0A.pdb.gz
17	PDB:6v9hC	0.212	0.733	9.325E-8	270	0.064	0.237	6v9hC.pdb.gz
18	PDB:6jd6B	0.166	0.805	3.199E-7	192	0.052	0.271	6jd6B.pdb.gz
19	PDB:6pqpA	0.179	0.279	5.713E-7	615	0.067	0.109	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:6mwqA	0.153	0.299	2.032E-6	493	0.107	0.215	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15084	0.0	1357	1053	0.687	0.648	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
2	Q8N8A2	0.0	2034	993	1.000	1.000	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
3	Q8NB46	0.0	1228	1076	0.616	0.569	ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3
4	P16157	4.05e-87	310	1881	0.260	0.137	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
5	X2JCM1	1.46e-86	308	11634	0.257	0.022	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
6	M9MRX4	3.48e-86	307	13559	0.257	0.019	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	Q7KU92	8.03e-85	303	4083	0.257	0.062	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
8	A8JNM6	8.09e-85	303	4189	0.257	0.061	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
9	M9MSK6	8.17e-85	303	4352	0.257	0.059	M9MSK6_DROME Ankyrin 2, isoform Q OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
10	M9MS19	8.65e-85	303	4230	0.257	0.060	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	A8JNM7	9.24e-85	303	4114	0.257	0.062	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
12	M9MRX1	1.09e-84	303	4329	0.257	0.059	M9MRX1_DROME Ankyrin 2, isoform S OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
13	M9MRR4	1.23e-84	303	4223	0.257	0.060	M9MRR4_DROME Ankyrin 2, isoform T OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
14	A0A8I5ZJ94	2.39e-84	301	1907	0.258	0.134	A0A8I5ZJ94_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=1
15	A0A8I5ZS64	2.83e-84	301	1878	0.258	0.136	A0A8I5ZS64_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=1
16	A8JNM5	2.84e-84	301	4264	0.257	0.060	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	A0A8I6GAS7	2.97e-84	301	1870	0.258	0.137	A0A8I6GAS7_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=1
18	M9MRS5	4.55e-84	301	4496	0.257	0.057	M9MRS5_DROME Ankyrin 2, isoform R OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	X2JC49	4.70e-84	301	4233	0.257	0.060	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	A0A8I6ABK4	4.80e-84	300	1852	0.258	0.138	A0A8I6ABK4_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	4.5e-147	484.2	Ankyrin repeat
2	PF12796 Ank_2	1.7e-162	539.8	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.2e-117	379.4	Ankyrin repeat
4	PF13637 Ank_4	1.1e-151	502.6	Ankyrin repeats (many copies)
5	PF13857 Ank_5	4.4e-116	388.7	Ankyrin repeats (many copies)
6	PF13537 GATase_7	14	17.1	Glutamine amidotransferase domain
7	PF01250 Ribosomal_S6	2.3e+02	13.5	Ribosomal protein S6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282272

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414202	0.960	Serine/threonine-protein phosphatase 6 regulatory subunit 1
2	9606.ENSP00000392147	0.943	Protein phosphatase 6 catalytic subunit
3	9606.ENSP00000377390	0.880	Serine/threonine-protein phosphatase 6 regulatory subunit 3
4	9606.ENSP00000478417	0.868	Serine/threonine-protein phosphatase 6 regulatory subunit 2
5	9606.ENSP00000382379	0.837	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
6	9606.ENSP00000457411	0.730	Ubiquitin carboxyl-terminal hydrolase 10
7	9606.ENSP00000380877	0.632	Activating signal cointegrator 1 complex subunit 2
8	9606.ENSP00000382104	0.630	Protein dopey-2
9	9606.ENSP00000295049	0.563	Raftlin-2
10	9606.ENSP00000414517	0.545	Mastermind-like domain-containing protein 1
11	9606.ENSP00000401947	0.539	Zinc finger protein 223
12	9606.ENSP00000395538	0.536	Trinucleotide repeat-containing gene 18 protein
13	9606.ENSP00000266087	0.534	F-box only protein 7
14	9606.ENSP00000302562	0.527	HSPB1-associated protein 1
15	9606.ENSP00000314792	0.515	Protein boule-like
16	9606.ENSP00000252136	0.511	tRNA (uracil-5-)-methyltransferase homolog A
17	9606.ENSP00000464087	0.509	E3 ubiquitin-protein ligase RNF213
18	9606.ENSP00000482786	0.503	Formiminotransferase cyclodeaminase N-terminal like
19	9606.ENSP00000397261	0.501	Selenium-binding protein 1
20	9606.ENSP00000352069	0.500	NEDD4-like E3 ubiquitin-protein ligase WWP2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0065007	0.959	biological regulation
GO:0050789	0.933	regulation of biological process
GO:0050794	0.818	regulation of cellular process
GO:0032501	0.488	multicellular organismal process
GO:0008152	0.355	metabolic process
GO:0071704	0.346	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005634	0.975	nucleus
GO:0031981	0.946	nuclear lumen
GO:0005654	0.939	nucleoplasm
GO:0016020	0.744	membrane
GO:0071944	0.386	cell periphery
GO:0005886	0.372	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]