StarFunc result for job id Q8N8E2

User Input

>input (541 residues)
MPRRKQSHPQPVKCEGVKVDTEDSLDEGPGALVLESDLLLGQDLEFEEEEEEEEGDGNSD
QLMGFERDSEGDSLGARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPAC
QLCGGPTGEGPCCGAGGPGGGPLLPPRLLYSCRLCTFVSHYSSHLKRHMQTHSGEKPFRC
GRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHAGPPTPPCPTCG
FRCCTPRPARPPSPTEQEGAVPRRPEDALLLPDLSLHVPPGGASFLPDCGQLRGEGEGLC
GTGSEPLPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGGASGGPQGPSDKGF
ACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPL
CPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAYT
TGHWDNYKRHQKVHGHGGAGGPGLSASEGWAPPHSPPSVLSSRGPPALGTAGSRAVHTDS
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PD29	0.314	0.314	5.996E-84	541	0.952	0.952	Q6PD29.pdb.gz	ZN513_MOUSE Zinc finger protein 513 OS=Mus musculus OX=10090 GN=Znf513 PE=1 SV=2
2	AFDB:Q68DI1	0.258	0.269	1.825E-24	518	0.203	0.212	Q68DI1.pdb.gz	ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens OX=9606 GN=ZNF776 PE=1 SV=2
3	AFDB:Q3USU9	0.250	0.215	2.068E-24	632	0.231	0.198	Q3USU9.pdb.gz	Q3USU9_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
4	AFDB:Q9Y2L8	0.240	0.159	5.292E-24	839	0.237	0.153	Q9Y2L8.pdb.gz	ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens OX=9606 GN=ZKSCAN5 PE=1 SV=1
5	AFDB:A2AWF2	0.248	0.198	5.634E-24	685	0.207	0.164	A2AWF2.pdb.gz	A2AWF2_MOUSE Reduced expression 2 OS=Mus musculus OX=10090 GN=Rex2 PE=1 SV=1
6	AFDB:A2A9J5	0.251	0.212	7.238E-24	645	0.201	0.169	A2A9J5.pdb.gz	A2A9J5_MOUSE Zinc finger protein 980 OS=Mus musculus OX=10090 GN=Zfp980 PE=4 SV=1
7	AFDB:O60765	0.221	0.200	1.272E-23	605	0.229	0.205	O60765.pdb.gz	Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens OX=9606 GN=ZNF354A PE=1 SV=2
8	AFDB:Q14585	0.253	0.278	2.871E-23	488	0.203	0.225	Q14585.pdb.gz	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
9	AFDB:M9PG92	0.238	0.167	4.450E-23	794	0.216	0.147	M9PG92.pdb.gz	M9PG92_DROME Jim, isoform G OS=Drosophila melanogaster OX=7227 GN=jim PE=4 SV=1
10	AFDB:Q9P0L1	0.238	0.174	8.862E-23	754	0.244	0.175	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
11	PDB:3w5kB	0.089	0.248	2.516E-4	110	0.063	0.309	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.031	0.156	1.042	62	0.018	0.161	6ydhA.pdb.gz
13	PDB:7uhyC	0.045	0.047	1.832	578	0.030	0.028	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:7uhyD	0.038	0.060	1.832	288	0.041	0.076	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:4wlwA	0.056	0.150	2.353	130	0.030	0.123	4wlwA.pdb.gz	TRANSCRIPTION. Allosteric transcriptional regulation via changes in the overall topology of the core promoter.
16	PDB:7vo0G	0.047	0.124	2.505	131	0.033	0.137	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
17	PDB:6yxyEI	0.044	0.075	3.648	275	0.041	0.080	6yxyEI.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
18	PDB:7uhyA	0.051	0.040	3.648	771	0.043	0.030	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:6wjvA	0.039	0.022	3.883	1951	0.043	0.012	6wjvA.pdb.gz
20	PDB:7o4iW	0.050	0.078	3.883	312	0.031	0.054	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PD29	0.0	899	541	0.952	0.952	ZN513_MOUSE Zinc finger protein 513 OS=Mus musculus OX=10090 GN=Znf513 PE=1 SV=2
2	Q8N8E2	0.0	1078	541	1.000	1.000	ZN513_HUMAN Zinc finger protein 513 OS=Homo sapiens OX=9606 GN=ZNF513 PE=1 SV=2
3	R4GDS0	5.18e-144	427	548	0.486	0.480	R4GDS0_DANRE Zinc finger protein 513a OS=Danio rerio OX=7955 GN=cb557 PE=4 SV=1
4	Q6ECI4	3.69e-43	166	717	0.207	0.156	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
5	Q15937	4.22e-43	162	498	0.205	0.223	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
6	Q14585	1.34e-42	160	488	0.213	0.236	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
7	Q9NQZ8	1.60e-42	160	489	0.233	0.258	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
8	P51523	1.97e-42	164	738	0.209	0.153	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
9	Q08ER8	3.40e-42	161	600	0.229	0.207	ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens OX=9606 GN=ZNF543 PE=1 SV=3
10	Q09FC8	4.86e-42	161	603	0.200	0.179	ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens OX=9606 GN=ZNF415 PE=1 SV=2
11	Q9NTW7	5.29e-42	161	645	0.224	0.188	ZF64B_HUMAN Zinc finger protein 64 OS=Homo sapiens OX=9606 GN=ZFP64 PE=1 SV=3
12	A0A0C4DG42	8.24e-42	159	539	0.200	0.200	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
13	Q61967	9.65e-42	160	636	0.216	0.184	ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus OX=10090 GN=Zfp90 PE=1 SV=1
14	Q8IZ26	1.63e-41	159	560	0.200	0.193	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
15	Q9Y2A4	1.87e-41	160	671	0.218	0.176	ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens OX=9606 GN=ZNF443 PE=2 SV=2
16	Q9EQB9	2.26e-41	160	759	0.213	0.152	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
17	Q99KE8	2.43e-41	159	643	0.216	0.182	ZFP64_MOUSE Zinc finger protein 64 OS=Mus musculus OX=10090 GN=Zfp64 PE=1 SV=1
18	Q9P0L1	3.85e-41	160	754	0.213	0.153	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
19	Q14C61	4.22e-41	159	627	0.209	0.180	Q14C61_HUMAN ZNF264 protein OS=Homo sapiens OX=9606 GN=ZNF264 PE=1 SV=1
20	E9QAG8	4.31e-41	157	526	0.207	0.213	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12013 OrsD	9e+02	11.7	Orsellinic acid/F9775 biosynthesis cluster protein D
2	PF00096 zf-C2H2	5.1e-17	72.4	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	2.3	20.3	C2H2-type zinc finger
4	PF16278 zf-C2HE	11	17.9	C2HE / C2H2 / C2HC zinc-binding finger
5	PF13465 zf-H2C2_2	2.7e-41	149.4	Zinc-finger double domain
6	PF13909 zf-H2C2_5	2.2e-27	105.7	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318373

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317123	0.791	U5 small nuclear ribonucleoprotein 200 kDa helicase
2	9606.ENSP00000266079	0.742	Pre-mRNA-processing factor 6
3	9606.ENSP00000249389	0.724	Short-wave-sensitive opsin 1
4	9606.ENSP00000315379	0.684	U4/U6 small nuclear ribonucleoprotein Prp3
5	9606.ENSP00000265909	0.660	Sorting nexin-19
6	9606.ENSP00000193391	0.654	Interphotoreceptor matrix proteoglycan 2
7	9606.ENSP00000332809	0.654	Uncharacterized protein C2orf71
8	9606.ENSP00000353104	0.647	Dehydrodolichyl diphosphate synthase complex subunit DHDDS
9	9606.ENSP00000463151	0.640	Retinol-binding protein 3
10	9606.ENSP00000341159	0.636	Ceramide kinase-like protein
11	9606.ENSP00000324122	0.619	U4/U6 small nuclear ribonucleoprotein Prp31
12	9606.ENSP00000465932	0.618	Progressive rod-cone degeneration protein
13	9606.ENSP00000358965	0.614	Uncharacterized protein C1orf194
14	9606.ENSP00000482306	0.614	Tetratricopeptide repeat protein 8
15	9606.ENSP00000385158	0.612	Protein FAM161A
16	9606.ENSP00000460348	0.610	Pre-mRNA-processing-splicing factor 8
17	9606.ENSP00000424243	0.607	Protein eyes shut homolog
18	9606.ENSP00000329158	0.602	Clarin-1
19	9606.ENSP00000286688	0.601	Protein C8orf37
20	9606.ENSP00000328412	0.601	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0000981	0.427	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.951	multicellular organismal process
GO:0001654	0.814	eye development
GO:0065007	0.808	biological regulation
GO:0043010	0.795	camera-type eye development
GO:0050789	0.771	regulation of biological process
GO:0009987	0.763	cellular process
GO:0050794	0.763	regulation of cellular process
GO:0060041	0.680	retina development in camera-type eye
GO:0060255	0.556	regulation of macromolecule metabolic process
GO:0051171	0.539	regulation of nitrogen compound metabolic process
GO:0080090	0.526	regulation of primary metabolic process
GO:0031323	0.305	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031981	0.885	nuclear lumen
GO:0005654	0.878	nucleoplasm
GO:0005737	0.653	cytoplasm
GO:0016020	0.348	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]