StarFunc result for job id Q8N8G2

User Input

>input (317 residues)
MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTP
ASIKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSS
KAPRSSGPWRDCSFPMSQRSFPASFWNSAYQAPVPPPLGSPLATAHSELPFAAADPYSPA
ALHGHLHQGATEPWHHAHPHHAHPHHPYALGGALGAQAAPYPRPAAVHEVYAPHFDPRYG
PLLMPAASGRPARLATAPAPAPGSPPCELSGKGEPAGAAWAGPGGPFASPSGDVAQGLGL
SVDSARRYSLCGASLLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N8G2	0.999	0.999	7.736E-49	317	1.000	1.000	Q8N8G2.pdb.gz	VGLL2_HUMAN Transcription cofactor vestigial-like protein 2 OS=Homo sapiens OX=9606 GN=VGLL2 PE=1 SV=1
2	AFDB:Q8BGW8	0.449	0.443	4.140E-39	322	0.858	0.845	Q8BGW8.pdb.gz	VGLL2_MOUSE Transcription cofactor vestigial-like protein 2 OS=Mus musculus OX=10090 GN=Vgll2 PE=1 SV=1
3	AFDB:Q8IJ76	0.084	0.078	9.847E-2	355	0.114	0.101	Q8IJ76.pdb.gz	Q8IJ76_PLAF7 Early transcribed membrane protein 10.2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1033200 PE=4 SV=1
4	AFDB:Q383R7	0.089	0.042	2.554E-1	865	0.167	0.061	Q383R7.pdb.gz	Q383R7_TRYB2 Trichohyalin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1880 PE=4 SV=1
5	AFDB:Q9ZPY0	0.092	0.081	2.927E-1	369	0.151	0.130	Q9ZPY0.pdb.gz	DOF25_ARATH Dof zinc finger protein DOF2.5 OS=Arabidopsis thaliana OX=3702 GN=DOF2.5 PE=2 SV=3
6	AFDB:O60563	0.075	0.041	8.128E-1	726	0.158	0.069	O60563.pdb.gz	CCNT1_HUMAN Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1
7	AFDB:O35817	0.084	0.059	1.840	502	0.186	0.118	O35817.pdb.gz	AKA14_RAT A-kinase anchor protein 14 OS=Rattus norvegicus OX=10116 GN=Akap14 PE=2 SV=1
8	AFDB:E7FCN3	0.084	0.048	2.108	649	0.186	0.091	E7FCN3.pdb.gz
9	AFDB:Q54K07	0.073	0.036	3.172	753	0.117	0.049	Q54K07.pdb.gz	Q54K07_DICDI Seipin OS=Dictyostelium discoideum OX=44689 GN=DDB_G0287697 PE=4 SV=1
10	AFDB:Q9FK37	0.080	0.049	4.165	584	0.107	0.058	Q9FK37.pdb.gz	Q9FK37_ARATH Uncharacterized protein At5g50350 OS=Arabidopsis thaliana OX=3702 GN=MXI22.6 PE=1 SV=1
11	PDB:1kyqB	0.062	0.071	5.614	273	0.016	0.018	1kyqB.pdb.gz	The structure of Saccharomyces cerevisiae Met8p, a bifunctional dehydrogenase and ferrochelatase.
12	PDB:3bbyA	0.057	0.086	7.890	191	0.016	0.026	3bbyA.pdb.gz	Crystal structure of glutathione S-transferase (NP_416804.1) from Escherichia coli K12 at 1.85 A resolution
13	PDB:5g3mA	0.057	0.124	9.678	123	0.028	0.073	5g3mA.pdb.gz	Discovery of Azd2716: A Novel Secreted Phospholipase A2 (Spla2) Inhibitor for the Treatment of Coronary Artery Disease
14	PDB:6hivCb	0.067	0.075	9.678	252	0.013	0.016	6hivCb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N8G2	0.0	627	317	1.000	1.000	VGLL2_HUMAN Transcription cofactor vestigial-like protein 2 OS=Homo sapiens OX=9606 GN=VGLL2 PE=1 SV=1
2	Q8BGW8	1.82e-166	467	322	0.849	0.835	VGLL2_MOUSE Transcription cofactor vestigial-like protein 2 OS=Mus musculus OX=10090 GN=Vgll2 PE=1 SV=1
3	Q4V8U0	9.63e-98	292	296	0.565	0.605	Q4V8U0_DANRE Si:dkeyp-93d12.1 OS=Danio rerio OX=7955 GN=si:dkeyp-93d12.1 PE=2 SV=1
4	A8MV65	1.20e-31	122	326	0.394	0.383	VGLL3_HUMAN Transcription cofactor vestigial-like protein 3 OS=Homo sapiens OX=9606 GN=VGLL3 PE=1 SV=1
5	Q26366	1.44e-12	70.1	453	0.129	0.091	VG_DROME Protein vestigial OS=Drosophila melanogaster OX=7227 GN=vg PE=1 SV=1
6	Q99990	7.44e-12	66.6	258	0.107	0.132	VGLL1_HUMAN Transcription cofactor vestigial-like protein 1 OS=Homo sapiens OX=9606 GN=VGLL1 PE=1 SV=1
7	Q99NC0	6.41e-06	49.3	307	0.069	0.072	VGLL1_MOUSE Transcription cofactor vestigial-like protein 1 OS=Mus musculus OX=10090 GN=Vgll1 PE=1 SV=1
8	Q9VWG3	0.68	33.1	160	0.079	0.156	RS10B_DROME Small ribosomal subunit protein eS10B OS=Drosophila melanogaster OX=7227 GN=RpS10b PE=1 SV=2
9	Q386T0	0.88	33.9	1436	0.107	0.024	Q386T0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0001 PE=4 SV=1
10	Q95YF0	1.4	33.1	1378	0.047	0.011	CLAP1_CAEEL Protein CLASP-1 OS=Caenorhabditis elegans OX=6239 GN=cls-1 PE=3 SV=1
11	Q12100	5.3	31.2	620	0.073	0.037	RTK1_YEAST Probable serine/threonine-protein kinase RTK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTK1 PE=1 SV=1
12	Q23551	8.8	30.8	7158	0.050	0.002	UNC22_CAEEL Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=3
13	H2FLH2	9.1	30.8	6927	0.050	0.002	H2FLH2_CAEEL Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=1
14	H2FLH3	9.1	30.8	6848	0.050	0.002	H2FLH3_CAEEL Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07545 Vg_Tdu	2.7e-17	73.6	Vestigial/Tondu family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320957

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000435233	0.987	Transcriptional enhancer factor TEF-1
2	9606.ENSP00000345772	0.894	Transcriptional enhancer factor TEF-5
3	9606.ENSP00000352926	0.865	Transcriptional enhancer factor TEF-3
4	9606.ENSP00000404251	0.838	Transcription cofactor vestigial-like protein 4
5	9606.ENSP00000472109	0.822	Transcriptional enhancer factor TEF-4
6	9606.ENSP00000419465	0.756	WW domain-containing transcription regulator protein 1
7	9606.ENSP00000478927	0.728	Transcriptional coactivator YAP1
8	9606.ENSP00000202816	0.636	ESF1 homolog
9	9606.ENSP00000296955	0.636	Discoidin, CUB and LCCL domain containing 1
10	9606.ENSP00000340874	0.621	Myocyte-specific enhancer factor 2C
11	9606.ENSP00000354777	0.598	TANK-binding kinase 1-binding protein 1
12	9606.ENSP00000346389	0.597	Myocyte-specific enhancer factor 2A
13	9606.ENSP00000356357	0.583	LIM/homeobox protein Lhx9
14	9606.ENSP00000357484	0.571	Golgi-associated PDZ and coiled-coil motif-containing protein
15	9606.ENSP00000290429	0.565	Malonyl-CoA-acyl carrier protein transacylase, mitochondrial
16	9606.ENSP00000453969	0.549	Uncharacterized protein C15orf52
17	9606.ENSP00000250003	0.546	Myoblast determination protein 1
18	9606.ENSP00000355645	0.528	Actin, alpha skeletal muscle
19	9606.ENSP00000226207	0.507	Myosin-1
20	9606.ENSP00000360552	0.503	Teashirt homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.890	transcription regulator activity
GO:0003712	0.417	transcription coregulator activity
GO:0003713	0.379	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.978	regulation of cellular process
GO:0019222	0.977	regulation of metabolic process
GO:0061061	0.950	muscle structure development
GO:0048518	0.947	positive regulation of biological process
GO:0006357	0.941	regulation of transcription by RNA polymerase II
GO:0009888	0.927	tissue development
GO:0007517	0.927	muscle organ development
GO:0045893	0.926	positive regulation of DNA-templated transcription
GO:0045944	0.876	positive regulation of transcription by RNA polymerase II
GO:0009987	0.775	cellular process
GO:0060538	0.764	skeletal muscle organ development
GO:0060537	0.702	muscle tissue development
GO:0032501	0.364	multicellular organismal process
GO:0007519	0.302	skeletal muscle tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005654	0.946	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]