StarFunc result for job id Q8N8Q8

User Input

>input (333 residues)
MLCRLGGRWLRPLPALQLWARDLPLAPVPTSGAKRPTLPVWAVAPVSAVHANGWYEALAA
SSPVRVAEEVLLGVHAATGLPWWGSILLSTVALRGAVTLPLAAYQHYILAKVENLQPEIK
TIARHLNQEVAVRANQLGWSKRDARLTYLKNMRRLISELYVRDNCHPFKATVLVWIQLPM
WIFMSFALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPDSTWILPISVGVINLLIVE
ICALQKIGMSRFQTYITYFVRAMSVLMIPIAATVPSSIVLYWLCSSFVGLSQNLLLRSPG
FRQLCRIPSTKSDSETPYKDIFAAFNTKFISRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N8Q8	1.000	1.000	1.833E-42	333	1.000	1.000	Q8N8Q8.pdb.gz	COX18_HUMAN Cytochrome c oxidase assembly protein COX18, mitochondrial OS=Homo sapiens OX=9606 GN=COX18 PE=1 SV=1
2	AFDB:Q8VC74	0.847	0.852	2.447E-35	331	0.778	0.782	Q8VC74.pdb.gz	COX18_MOUSE Cytochrome c oxidase assembly protein COX18, mitochondrial OS=Mus musculus OX=10090 GN=Cox18 PE=1 SV=5
3	AFDB:Q42191	0.610	0.481	4.560E-12	429	0.246	0.191	Q42191.pdb.gz	OXA1_ARATH Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana OX=3702 GN=OXA1 PE=2 SV=2
4	AFDB:Q9Y171	0.604	0.466	7.993E-12	441	0.255	0.193	Q9Y171.pdb.gz	Q9Y171_DROME BcDNA.GH02220 OS=Drosophila melanogaster OX=7227 GN=OXA1L PE=2 SV=1
5	AFDB:Q2M1J6	0.602	0.415	2.066E-11	496	0.237	0.159	Q2M1J6.pdb.gz	Q2M1J6_HUMAN Oxidase (Cytochrome c) assembly 1-like OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=1
6	AFDB:Q8BGA9	0.610	0.478	2.158E-11	433	0.237	0.182	Q8BGA9.pdb.gz	OXA1L_MOUSE Mitochondrial inner membrane protein OXA1L OS=Mus musculus OX=10090 GN=Oxa1l PE=1 SV=1
7	AFDB:O43092	0.616	0.508	9.778E-11	409	0.231	0.188	O43092.pdb.gz	OXA12_SCHPO Mitochondrial inner membrane protein oxa1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oxa102 PE=2 SV=2
8	AFDB:P39952	0.540	0.454	2.190E-9	402	0.204	0.169	P39952.pdb.gz	OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OXA1 PE=1 SV=1
9	AFDB:O02207	0.542	0.497	5.911E-9	366	0.186	0.169	O02207.pdb.gz	O02207_CAEEL OXA mitochondrial inner membrane insertase homolog OS=Caenorhabditis elegans OX=6239 GN=oxa-1 PE=1 SV=2
10	AFDB:O14300	0.580	0.521	6.444E-9	374	0.186	0.166	O14300.pdb.gz	OXA11_SCHPO Mitochondrial inner membrane protein oxa1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oxa101 PE=2 SV=1
11	PDB:6al2A	0.451	0.324	5.727E-6	484	0.171	0.118	6al2A.pdb.gz
12	PDB:5mg3C	0.363	0.280	6.429E-2	455	0.171	0.125	5mg3C.pdb.gz
13	PDB:5m5hA	0.172	0.381	3.463E-1	132	0.081	0.205	5m5hA.pdb.gz
14	PDB:7f61A	0.148	0.157	1.711	301	0.123	0.136	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
15	PDB:2j68A	0.131	0.075	1.787	680	0.132	0.065	2j68A.pdb.gz	A Bacterial Dynamin-Like Protein
16	PDB:1ekuB	0.126	0.148	1.865	254	0.063	0.083	1ekuB.pdb.gz
17	PDB:7p54A	0.141	0.124	1.865	397	0.123	0.103	7p54A.pdb.gz
18	PDB:7cf9A	0.112	0.021	2.034	3949	0.087	0.007	7cf9A.pdb.gz	Structural basis for diamide modulation of ryanodine receptor.
19	PDB:4ad7C	0.117	0.107	2.315	385	0.114	0.099	4ad7C.pdb.gz
20	PDB:7ajlAAA	0.108	0.119	2.524	290	0.123	0.141	7ajlAAA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N8Q8	0.0	676	333	1.000	1.000	COX18_HUMAN Cytochrome c oxidase assembly protein COX18, mitochondrial OS=Homo sapiens OX=9606 GN=COX18 PE=1 SV=1
2	Q8VC74	0.0	509	331	0.781	0.785	COX18_MOUSE Cytochrome c oxidase assembly protein COX18, mitochondrial OS=Mus musculus OX=10090 GN=Cox18 PE=1 SV=5
3	Q42191	5.12e-26	109	429	0.231	0.179	OXA1_ARATH Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana OX=3702 GN=OXA1 PE=2 SV=2
4	Q9Y171	6.82e-24	103	441	0.219	0.166	Q9Y171_DROME BcDNA.GH02220 OS=Drosophila melanogaster OX=7227 GN=OXA1L PE=2 SV=1
5	Q8BGA9	3.28e-22	98.6	433	0.210	0.162	OXA1L_MOUSE Mitochondrial inner membrane protein OXA1L OS=Mus musculus OX=10090 GN=Oxa1l PE=1 SV=1
6	Q15070	9.37e-22	97.4	435	0.204	0.156	OXA1L_HUMAN Mitochondrial inner membrane protein OXA1L OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=3
7	A0A087X0L7	1.03e-21	97.4	435	0.204	0.156	A0A087X0L7_HUMAN OXA1L mitochondrial inner membrane protein OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=1
8	Q2M1J6	1.38e-21	97.4	496	0.204	0.137	Q2M1J6_HUMAN Oxidase (Cytochrome c) assembly 1-like OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=1
9	J3KNA0	1.41e-21	97.4	495	0.204	0.137	J3KNA0_HUMAN OXA1L mitochondrial inner membrane protein OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=1
10	O94587	2.28e-15	75.9	202	0.204	0.337	COX18_SCHPO Cytochrome c oxidase assembly protein cox18, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox18 PE=3 SV=1
11	O14300	2.56e-14	75.1	374	0.192	0.171	OXA11_SCHPO Mitochondrial inner membrane protein oxa1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oxa101 PE=2 SV=1
12	O43092	1.61e-12	70.1	409	0.198	0.161	OXA12_SCHPO Mitochondrial inner membrane protein oxa1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oxa102 PE=2 SV=2
13	P39952	2.08e-11	66.6	402	0.165	0.137	OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OXA1 PE=1 SV=1
14	Q385F4	6.48e-09	58.9	418	0.168	0.134	Q385F4_TRYB2 60Kd inner membrane protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4020 PE=4 SV=1
15	P53239	7.45e-09	58.5	316	0.201	0.212	COX18_YEAST Cytochrome c oxidase assembly protein COX18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX18 PE=1 SV=1
16	P25714	4.94e-07	53.5	548	0.180	0.109	YIDC_ECOLI Membrane protein insertase YidC OS=Escherichia coli (strain K12) OX=83333 GN=yidC PE=1 SV=2
17	Q8L718	1.50e-06	52.0	525	0.192	0.122	ALB32_ARATH ALBINO3-like protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALB3L2 PE=2 SV=2
18	Q8LBP4	4.78e-06	50.4	462	0.210	0.152	ALB3_ARATH Inner membrane protein ALBINO3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALB3 PE=1 SV=2
19	Q38DZ8	1.09e-05	49.3	424	0.108	0.085	Q38DZ8_TRYB2 60Kd inner membrane protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1580 PE=4 SV=1
20	O02207	5.28e-04	43.9	366	0.159	0.145	O02207_CAEEL OXA mitochondrial inner membrane insertase homolog OS=Caenorhabditis elegans OX=6239 GN=oxa-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02096 60KD_IMP	6e-14	63.8	60Kd inner membrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000425261

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000406327	0.935	Cytochrome c oxidase protein 20 homolog
2	9606.ENSP00000307786	0.922	Cytochrome c
3	9606.ENSP00000354876	0.899	Cytochrome c oxidase subunit 2
4	9606.ENSP00000253099	0.815	Mitochondrial ribosomal protein L4
5	9606.ENSP00000299335	0.797	Cytochrome c oxidase assembly protein COX11, mitochondrial
6	9606.ENSP00000255390	0.796	Protein SCO1 homolog, mitochondrial
7	9606.ENSP00000387262	0.791	MICOS complex subunit MIC60
8	9606.ENSP00000261070	0.775	Cytochrome c oxidase copper chaperone
9	9606.ENSP00000016171	0.773	Cytochrome c oxidase assembly protein COX15 homolog
10	9606.ENSP00000410339	0.763	Mitochondrial import receptor subunit TOM40 homolog
11	9606.ENSP00000342015	0.756	Cytochrome c oxidase assembly protein COX19
12	9606.ENSP00000320658	0.752	Tyrosine--tRNA ligase, mitochondrial
13	9606.ENSP00000355572	0.736	Cytochrome c oxidase assembly factor 6 homolog
14	9606.ENSP00000445806	0.713	Mitochondrial import inner membrane translocase subunit TIM50
15	9606.ENSP00000356967	0.705	Mitochondrial import receptor subunit TOM40B
16	9606.ENSP00000354632	0.702	ATP synthase subunit a
17	9606.ENSP00000306397	0.687	Cytochrome b-c1 complex subunit Rieske, mitochondrial
18	9606.ENSP00000273859	0.682	Probable phospholipid-transporting ATPase VD
19	9606.ENSP00000284727	0.682	ATP synthase F(0) complex subunit C3, mitochondrial
20	9606.ENSP00000381736	0.680	ATP synthase subunit alpha, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032977	1.000	membrane insertase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0006839	0.977	mitochondrial transport
GO:0006886	0.974	intracellular protein transport
GO:0017004	0.969	cytochrome complex assembly
GO:0072655	0.969	establishment of protein localization to mitochondrion
GO:0007006	0.959	mitochondrial membrane organization
GO:0033108	0.958	mitochondrial respiratory chain complex assembly
GO:0090151	0.943	establishment of protein localization to mitochondrial membrane
GO:0051204	0.929	protein insertion into mitochondrial membrane
GO:0008535	0.914	respiratory chain complex IV assembly
GO:0033617	0.900	mitochondrial cytochrome c oxidase assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.992	membrane
GO:0031090	0.913	organelle membrane
GO:0031967	0.899	organelle envelope
GO:0005740	0.863	mitochondrial envelope
GO:0031966	0.854	mitochondrial membrane
GO:0005743	0.830	mitochondrial inner membrane
GO:0070013	0.734	intracellular organelle lumen
GO:0032991	0.519	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]