StarFunc result for job id Q8N8R3

User Input

>input (303 residues)
MALDFLAGCAGGVAGVLVGHPFDTVKVRLQVQSVEKPQYRGTLHCFKSIIKQESVLGLYK
GLGSPLMGLTFINALVFGVQGNTLRALGHDSPLNQFLAGAAAGAIQCVICCPMELAKTRL
QLQDAGPARTYKGSLDCLAQIYGHEGLRGVNRGMVSTLLRETPSFGVYFLTYDALTRALG
CEPGDRLLVPKLLLAGGTSGIVSWLSTYPVDVVKSRLQADGLRGAPRYRGILDCVHQSYR
AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPAAPAGPALAQP
SSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N8R3	1.000	1.000	1.784E-42	303	1.000	1.000	Q8N8R3.pdb.gz	S2529_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens OX=9606 GN=SLC25A29 PE=1 SV=2
2	AFDB:Q8BL03	0.920	0.911	1.742E-36	306	0.888	0.879	Q8BL03.pdb.gz	S2529_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus OX=10090 GN=Slc25a29 PE=1 SV=1
3	AFDB:Q8CFJ7	0.833	0.875	2.889E-20	288	0.393	0.413	Q8CFJ7.pdb.gz	S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus OX=10090 GN=Slc25a45 PE=1 SV=1
4	AFDB:Q8BW66	0.801	0.794	4.557E-19	306	0.376	0.373	Q8BW66.pdb.gz	S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus OX=10090 GN=Slc25a48 PE=1 SV=2
5	AFDB:Q6IS41	0.832	0.814	1.247E-18	310	0.383	0.374	Q6IS41.pdb.gz	S2547_MOUSE Solute carrier family 25 member 47 OS=Mus musculus OX=10090 GN=Slc25a47 PE=1 SV=2
6	AFDB:Q6ZT89	0.822	0.802	3.568E-18	311	0.383	0.373	Q6ZT89.pdb.gz	S2548_HUMAN Solute carrier family 25 member 48 OS=Homo sapiens OX=9606 GN=SLC25A48 PE=1 SV=2
7	AFDB:O43772	0.756	0.761	3.185E-17	301	0.350	0.352	O43772.pdb.gz	MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens OX=9606 GN=SLC25A20 PE=1 SV=1
8	AFDB:Q93XM7	0.795	0.802	3.964E-17	300	0.330	0.333	Q93XM7.pdb.gz	MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=BOU PE=1 SV=1
9	AFDB:Q9VQG4	0.771	0.764	6.417E-17	306	0.350	0.346	Q9VQG4.pdb.gz	COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster OX=7227 GN=colt PE=2 SV=1
10	AFDB:Q84UC7	0.788	0.770	1.134E-16	311	0.323	0.315	Q84UC7.pdb.gz	BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana OX=3702 GN=BAC1 PE=1 SV=1
11	PDB:4c9qB	0.745	0.776	3.623E-11	290	0.218	0.228	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.759	0.783	5.614E-11	293	0.238	0.246	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.527	0.542	1.770E-7	292	0.201	0.209	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:6rcuA	0.208	0.208	1.655E-1	304	0.086	0.086	6rcuA.pdb.gz
15	PDB:7p5jA	0.118	0.096	2.798E-1	399	0.155	0.118	7p5jA.pdb.gz
16	PDB:6xboA	0.134	0.128	4.149E-1	319	0.142	0.135	6xboA.pdb.gz	Inhibition of CMP-sialic acid transport by endogenous 5-methyl CMP.
17	PDB:6rx4B	0.212	0.180	4.732E-1	379	0.096	0.077	6rx4B.pdb.gz	Homologous bd oxidases share the same architecture but differ in mechanism.
18	PDB:7p5cA	0.116	0.097	4.944E-1	392	0.142	0.110	7p5cA.pdb.gz
19	PDB:7dskB	0.151	0.106	5.637E-1	464	0.132	0.086	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
20	PDB:3kdzA	0.153	0.105	6.153E-1	527	0.116	0.066	3kdzA.pdb.gz	Probing the active site of MIO-dependent aminomutases, key catalysts in the biosynthesis of beta-amino acids incorporated in secondary metabolites

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BL03	0.0	551	306	0.894	0.886	S2529_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus OX=10090 GN=Slc25a29 PE=1 SV=1
2	Q8N8R3	0.0	612	303	1.000	1.000	S2529_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens OX=9606 GN=SLC25A29 PE=1 SV=2
3	Q8CFJ7	8.71e-66	209	288	0.396	0.417	S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus OX=10090 GN=Slc25a45 PE=1 SV=1
4	Q6ZT89	3.68e-57	188	311	0.389	0.379	S2548_HUMAN Solute carrier family 25 member 48 OS=Homo sapiens OX=9606 GN=SLC25A48 PE=1 SV=2
5	Q8BW66	3.97e-57	188	306	0.380	0.376	S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus OX=10090 GN=Slc25a48 PE=1 SV=2
6	Q6IS41	4.38e-54	180	310	0.376	0.368	S2547_MOUSE Solute carrier family 25 member 47 OS=Mus musculus OX=10090 GN=Slc25a47 PE=1 SV=2
7	Q9Z2Z6	6.55e-53	177	301	0.350	0.352	MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus OX=10090 GN=Slc25a20 PE=1 SV=1
8	O43772	1.55e-51	173	301	0.353	0.355	MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens OX=9606 GN=SLC25A20 PE=1 SV=1
9	Q27257	6.06e-51	172	312	0.383	0.372	DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans OX=6239 GN=dif-1 PE=2 SV=1
10	P97521	9.99e-51	171	301	0.343	0.346	MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus OX=10116 GN=Slc25a20 PE=1 SV=1
11	Q9VQG4	3.11e-49	167	306	0.360	0.356	COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster OX=7227 GN=colt PE=2 SV=1
12	Q93XM7	4.29e-48	164	300	0.350	0.353	MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=BOU PE=1 SV=1
13	Q9CA93	1.27e-46	160	296	0.320	0.328	BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana OX=3702 GN=BAC2 PE=1 SV=1
14	P38087	4.62e-46	160	329	0.356	0.328	YMC2_YEAST Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMC2 PE=1 SV=1
15	P32331	8.06e-42	148	307	0.340	0.336	YMC1_YEAST Mitochondrial glycine transporter YMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMC1 PE=1 SV=2
16	Q9VM51	1.02e-41	147	299	0.333	0.338	MME1_DROME Mitochondrial magnesium exporter 1 OS=Drosophila melanogaster OX=7227 GN=MME1 PE=2 SV=1
17	Q84UC7	2.01e-41	147	311	0.337	0.328	BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana OX=3702 GN=BAC1 PE=1 SV=1
18	Q385N9	5.56e-40	142	282	0.333	0.358	Q385N9_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2960 PE=3 SV=1
19	Q5A967	6.17e-40	142	284	0.300	0.320	Q5A967_CANAL Carnitine:acyl carnitine antiporter OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRC1 PE=3 SV=1
20	G5EB24	3.08e-38	139	326	0.356	0.331	G5EB24_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05356 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13443 HTH_26	3.8e+02	12.9	Cro/C1-type HTH DNA-binding domain
2	PF00153 Mito_carr	2.6e-62	218.1	Mitochondrial carrier protein
3	PF02466 Tim17	1.4e+02	14.3	Tim17/Tim22/Tim23/Pmp24 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352167

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326305	0.823	Mitochondrial carnitine/acylcarnitine carrier protein
2	9606.ENSP00000315017	0.656	Mitochondrial ribosomal protein L1
3	9606.ENSP00000386377	0.605	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
4	9606.ENSP00000296862	0.598	Adhesion G-protein coupled receptor F2
5	9606.ENSP00000275162	0.559	Clavesin-2
6	9606.ENSP00000305334	0.559	Follistatin-related protein 5
7	9606.ENSP00000277865	0.558	Glutamate dehydrogenase 1, mitochondrial
8	9606.ENSP00000461324	0.532	Involved in translocation of malonate, malate and succinate in exchange for phosphate, sulfate, sulfite or thiosulfate across mitochondrial inner membrane
9	9606.ENSP00000446242	0.526	Mitochondrial dicarboxylate carrier
10	9606.ENSP00000274938	0.511	Signal peptide, CUB and EGF-like domain-containing protein 3
11	9606.ENSP00000399392	0.508	TPA-induced transmembrane protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015174	0.999	basic amino acid transmembrane transporter activity
GO:0061459	0.989	L-arginine transmembrane transporter activity
GO:1901702	0.975	salt transmembrane transporter activity
GO:0005488	0.930	binding
GO:0005515	0.850	protein binding
GO:0015189	0.816	L-lysine transmembrane transporter activity
GO:0022804	0.305	active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1905039	0.996	carboxylic acid transmembrane transport
GO:0003333	0.986	amino acid transmembrane transport
GO:1990542	0.971	mitochondrial transmembrane transport
GO:1902475	0.959	L-alpha-amino acid transmembrane transport
GO:0015802	0.414	basic amino acid transport
GO:0008152	0.388	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.986	membrane
GO:0031090	0.971	organelle membrane
GO:0031966	0.933	mitochondrial membrane
GO:0005743	0.894	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:32143	0.989	L-arginine(in) = L-arginine(out)

[back to server]