StarFunc result for job id Q8N8U2

User Input

>input (506 residues)
MASGDLYEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHM
SKDKRIKSGKQSSTSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKRKRINPPLAKPKKGY
SGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENGDAGSEKDERHFGNGSHQPGLD
LNDHVGEQDMGECDVNHATLAENGLGSALTNGGLNLHSPVKRKLEAEKDYVFDKRLRYSV
RQNESNCRFRDIVVRKEEGFTHILLSSQTSDNNALTPEIMKEVRRALCNAATDDSKLLLL
SAVGSVFCSGLDYSYLIGRLSSDRRKESTRIAEAIRDFVKAFIQFKKPIVVAINGPALGL
GASILPLCDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQ
EACSRGLVSQVFWPTTFSQEVMLRVKEMASCSAVVLEESKCLVRSFLKSVLEDVNEKECL
MLKQLWSSSKGLDSLFSYLQDKIYEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N8U2	1.000	1.000	3.261E-84	506	1.000	1.000	Q8N8U2.pdb.gz	CDYL2_HUMAN Chromodomain Y-like protein 2 OS=Homo sapiens OX=9606 GN=CDYL2 PE=1 SV=2
2	AFDB:Q9Y232	0.528	0.448	9.949E-52	598	0.516	0.436	Q9Y232.pdb.gz	CDYL_HUMAN Chromodomain Y-like protein OS=Homo sapiens OX=9606 GN=CDYL PE=1 SV=2
3	AFDB:Q9WTK2	0.519	0.444	7.018E-51	593	0.518	0.442	Q9WTK2.pdb.gz	CDYL_MOUSE Chromodomain Y-like protein OS=Mus musculus OX=10090 GN=Cdyl PE=1 SV=1
4	AFDB:Q9Y6F7	0.532	0.499	4.617E-49	541	0.435	0.407	Q9Y6F7.pdb.gz	CDY2_HUMAN Testis-specific chromodomain protein Y 2 OS=Homo sapiens OX=9606 GN=CDY2A PE=1 SV=1
5	AFDB:O75521	0.484	0.617	2.912E-28	394	0.196	0.251	O75521.pdb.gz	ECI2_HUMAN Enoyl-CoA delta isomerase 2 OS=Homo sapiens OX=9606 GN=ECI2 PE=1 SV=4
6	AFDB:Q9WUR2	0.487	0.627	6.016E-28	391	0.190	0.246	Q9WUR2.pdb.gz	ECI2_MOUSE Enoyl-CoA delta isomerase 2 OS=Mus musculus OX=10090 GN=Eci2 PE=1 SV=2
7	AFDB:Q5XIC0	0.485	0.624	2.265E-26	391	0.188	0.243	Q5XIC0.pdb.gz	ECI2_RAT Enoyl-CoA delta isomerase 2 OS=Rattus norvegicus OX=10116 GN=Eci2 PE=1 SV=1
8	AFDB:Q09603	0.494	0.643	4.679E-26	385	0.156	0.205	Q09603.pdb.gz	Q09603_CAEEL ACB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ech-4 PE=1 SV=1
9	AFDB:Q78JN3	0.478	0.751	3.301E-25	317	0.192	0.306	Q78JN3.pdb.gz	ECI3_MOUSE Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus OX=10090 GN=Eci3 PE=1 SV=1
10	AFDB:Q8MR61	0.492	0.918	7.415E-23	265	0.132	0.253	Q8MR61.pdb.gz	Q8MR61_DROME GH11143p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dci PE=2 SV=1
11	PDB:1k39B	0.452	0.821	1.515E-17	271	0.128	0.240	1k39B.pdb.gz	Crystallization and X-ray diffraction analysis of peroxisomal Delta3-Delta2-enoyl-CoA isomerase from Saccharomyces cerevisiae
12	PDB:2hw5C	0.398	0.751	4.375E-17	260	0.119	0.231	2hw5C.pdb.gz	The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
13	PDB:5zaiC	0.407	0.774	5.172E-17	259	0.123	0.239	5zaiC.pdb.gz	Structural Insight into Substrate Specificity of 3-Hydroxypropionyl-Coenzyme A Dehydratase from Metallosphaera sedula
14	PDB:3h81A	0.403	0.775	1.336E-16	256	0.105	0.207	3h81A.pdb.gz	Increasing the structural coverage of tuberculosis drug targets.
15	PDB:4fzwB	0.372	0.717	1.336E-16	256	0.128	0.254	4fzwB.pdb.gz
16	PDB:1jxzB	0.401	0.734	1.766E-16	269	0.128	0.242	1jxzB.pdb.gz	Histidine 90 Function in 4-chlorobenzoyl-coenzyme A Dehalogenase Catalysis
17	PDB:1dubA	0.399	0.749	1.975E-16	260	0.117	0.227	1dubA.pdb.gz	Crystal structure of enoyl-coenzyme A (CoA) hydratase at 2.5 angstroms resolution: a spiral fold defines the CoA-binding pocket.
18	PDB:5dtwC	0.395	0.758	2.919E-16	246	0.107	0.220	5dtwC.pdb.gz	THPP target assignment reveals EchA6 as an essential fatty acid shuttle in mycobacteria.
19	PDB:1szoD	0.413	0.796	1.647E-15	251	0.097	0.195	1szoD.pdb.gz	Structure of 6-oxo camphor hydrolase H122A mutant bound to its natural product, (2S,4S)-alpha-campholinic acid: mutant structure suggests an atypical mode of transition state binding for a crotonase homolog.
20	PDB:4i42A	0.406	0.694	7.860E-15	285	0.128	0.228	4i42A.pdb.gz	Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme A synthase from the crotonase fold superfamily

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N8U2	0.0	1050	506	1.000	1.000	CDYL2_HUMAN Chromodomain Y-like protein 2 OS=Homo sapiens OX=9606 GN=CDYL2 PE=1 SV=2
2	Q9D5D8	0.0	964	503	0.915	0.920	CDYL2_MOUSE Chromodomain Y-like protein 2 OS=Mus musculus OX=10090 GN=Cdyl2 PE=1 SV=1
3	Q9Y232	6.45e-170	494	598	0.540	0.457	CDYL_HUMAN Chromodomain Y-like protein OS=Homo sapiens OX=9606 GN=CDYL PE=1 SV=2
4	Q9WTK2	1.20e-167	488	593	0.536	0.457	CDYL_MOUSE Chromodomain Y-like protein OS=Mus musculus OX=10090 GN=Cdyl PE=1 SV=1
5	Q9Y6F7	2.09e-137	409	541	0.447	0.418	CDY2_HUMAN Testis-specific chromodomain protein Y 2 OS=Homo sapiens OX=9606 GN=CDY2A PE=1 SV=1
6	Q9Y6F8	8.77e-136	405	540	0.443	0.415	CDY1_HUMAN Testis-specific chromodomain protein Y 1 OS=Homo sapiens OX=9606 GN=CDY1 PE=1 SV=1
7	A0A0C4DGA2	3.25e-51	180	364	0.190	0.264	A0A0C4DGA2_HUMAN Enoyl-CoA delta isomerase 2 OS=Homo sapiens OX=9606 GN=ECI2 PE=1 SV=1
8	O75521	2.01e-50	179	394	0.190	0.244	ECI2_HUMAN Enoyl-CoA delta isomerase 2 OS=Homo sapiens OX=9606 GN=ECI2 PE=1 SV=4
9	Q9WUR2	2.42e-50	179	391	0.188	0.243	ECI2_MOUSE Enoyl-CoA delta isomerase 2 OS=Mus musculus OX=10090 GN=Eci2 PE=1 SV=2
10	Q5XIC0	1.38e-49	176	391	0.190	0.246	ECI2_RAT Enoyl-CoA delta isomerase 2 OS=Rattus norvegicus OX=10116 GN=Eci2 PE=1 SV=1
11	Q78JN3	7.00e-48	170	317	0.186	0.297	ECI3_MOUSE Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus OX=10090 GN=Eci3 PE=1 SV=1
12	Q09603	1.68e-31	127	385	0.148	0.195	Q09603_CAEEL ACB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ech-4 PE=1 SV=1
13	Q8MR61	1.50e-25	107	265	0.136	0.260	Q8MR61_DROME GH11143p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dci PE=2 SV=1
14	Q9W0M0	1.89e-25	107	262	0.134	0.260	Q9W0M0_DROME Dodecenoyl-CoA delta-isomerase OS=Drosophila melanogaster OX=7227 GN=Dci PE=1 SV=1
15	Q3MIE0	7.07e-19	89.4	300	0.140	0.237	ECHD3_RAT Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echdc3 PE=2 SV=1
16	Q9D7J9	1.51e-17	85.5	300	0.136	0.230	ECHD3_MOUSE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Mus musculus OX=10090 GN=Echdc3 PE=1 SV=1
17	Q8BH95	4.16e-17	84.0	290	0.126	0.221	ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Echs1 PE=1 SV=1
18	P14604	9.25e-17	82.8	290	0.123	0.214	ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echs1 PE=1 SV=1
19	Q96DC8	1.25e-16	82.8	303	0.140	0.234	ECHD3_HUMAN Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=ECHDC3 PE=1 SV=2
20	P30084	2.21e-16	82.0	290	0.126	0.221	ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00385 Chromo	2.7e-13	60.9	Chromo (CHRromatin Organisation MOdifier) domain
2	PF00378 ECH_1	2.5e-27	107.3	Enoyl-CoA hydratase/isomerase
3	PF16113 ECH_2	2.2e-09	48.9	Enoyl-CoA hydratase/isomerase
4	PF14061 Mtf2_C	39	15.9	Polycomb-like MTF2 factor 2
5	PF11952 XTBD	2.5e+02	12.8	XRN-Two Binding Domain, XTBD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000476295

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000476960	0.863	Histone cluster 2 H3 pseudogene 2
2	9606.ENSP00000366999	0.851	Histone cluster 1 H3 family member d
3	9606.ENSP00000482271	0.851	Histone cluster 1 H3 family member e
4	9606.ENSP00000484658	0.851	Histone cluster 1 H3 family member c
5	9606.ENSP00000355657	0.850	Histone H3.1t
6	9606.ENSP00000352252	0.849	Histone cluster 1 H3 family member j
7	9606.ENSP00000358160	0.849	Histone cluster 1 H3 family member h
8	9606.ENSP00000480826	0.849	Histone cluster 1 H3 family member a
9	9606.ENSP00000483283	0.849	Histone cluster 1 H3 family member i
10	9606.ENSP00000484095	0.849	Histone cluster 1 H3 family member f
11	9606.ENSP00000484638	0.849	Histone cluster 1 H3 family member g
12	9606.ENSP00000484841	0.849	Histone H3.1
13	9606.ENSP00000333277	0.846	Histone cluster 2 H3 family member d
14	9606.ENSP00000358154	0.846	Histone cluster 2 H3 family member c
15	9606.ENSP00000385479	0.846	Histone H3.2
16	9606.ENSP00000299642	0.715	C-type lectin domain family 3 member A
17	9606.ENSP00000299601	0.700	RNA polymerase-associated protein LEO1
18	9606.ENSP00000360569	0.677	Non-specific lipid-transfer protein
19	9606.ENSP00000437256	0.647	Endoribonuclease Dicer
20	9606.ENSP00000369666	0.599	F-box/LRR-repeat protein 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.833	catalytic activity
GO:0140030	0.657	modification-dependent protein binding
GO:0042393	0.411	histone binding
GO:0140034	0.372	methylation-dependent protein binding
GO:0035064	0.352	methylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0000003	0.994	reproduction
GO:0050789	0.977	regulation of biological process
GO:0019222	0.947	regulation of metabolic process
GO:0060255	0.885	regulation of macromolecule metabolic process
GO:0032502	0.882	developmental process
GO:0032501	0.841	multicellular organismal process
GO:0051171	0.815	regulation of nitrogen compound metabolic process
GO:0080090	0.725	regulation of primary metabolic process
GO:0009987	0.643	cellular process
GO:0050794	0.606	regulation of cellular process
GO:0048519	0.594	negative regulation of biological process
GO:0022414	0.502	reproductive process
GO:0007276	0.487	gamete generation
GO:0003006	0.467	developmental process involved in reproduction
GO:0008152	0.390	metabolic process
GO:0071704	0.378	organic substance metabolic process
GO:0010468	0.375	regulation of gene expression
GO:0031323	0.359	regulation of cellular metabolic process
GO:0048232	0.316	male gamete generation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.920	intracellular organelle lumen
GO:0031981	0.890	nuclear lumen
GO:0005654	0.857	nucleoplasm
GO:0005737	0.779	cytoplasm
GO:0032991	0.443	protein-containing complex
GO:0043232	0.307	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]