StarFunc result for job id Q8N8U9

User Input

>input (685 residues)
MLWFSGVGALAERYCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIP
FITDNPCIMCVCLNKEVTCKREKCPVLSRDCALAIKQRGACCEQCKGCTYEGNTYNSSFK
WQSPAEPCVLRQCQEGVVTESGVRCVVHCKNPLEHLGMCCPTCPGCVFEGVQYQEGEEFQ
PEGSKCTKCSCTGGRTQCVREVCPILSCPQHLSHIPPGQCCPKCLGQRKVFDLPFGSCLF
RSDVYDNGSSFLYDNCTACTCRDSTVVCKRKCSHPGGCDQGQEGCCEECLLRVPPEDIKV
CKFGNKIFQDGEMWSSINCTICACVKGRTECRNKQCIPISSCPQGKILNRKGCCPICTEK
PGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKS
VELVLGESRVSLQQHLTVRWNGSRIALPCRAPHFHIDLDGYLLKVTTKAGLEISWDGDSF
VEVMAAPHLKGKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRK
PVPELCQGTVKVKLRAHRECQKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCE
SFLAYTRACQREGIKVHWEPQQNCAATQCKHGAVYDTCGPGCIKTCDNWNEIGPCNKPCV
AGCHCPANLVLHKGRCIKPVLCPQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6H8K2	0.504	0.517	0.000	668	0.658	0.675	A6H8K2.pdb.gz	A6H8K2_DANRE BMP-binding endothelial regulator protein precursor OS=Danio rerio OX=7955 GN=cvl2 PE=2 SV=1
2	AFDB:Q8CJ69	0.802	0.802	0.000	685	0.927	0.927	Q8CJ69.pdb.gz	BMPER_MOUSE BMP-binding endothelial regulator protein OS=Mus musculus OX=10090 GN=Bmper PE=1 SV=1
3	AFDB:Q3U492	0.427	0.205	9.361E-60	1550	0.323	0.143	Q3U492.pdb.gz	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
4	AFDB:Q9GYX3	0.409	0.384	1.374E-59	751	0.317	0.289	Q9GYX3.pdb.gz	Q9GYX3_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
5	AFDB:Q28983	0.405	0.125	7.316E-34	2476	0.212	0.059	Q28983.pdb.gz	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
6	AFDB:O08523	0.393	0.136	2.198E-30	2155	0.158	0.050	O08523.pdb.gz	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
7	AFDB:Q98UI9	0.350	0.121	1.273E-28	2108	0.180	0.058	Q98UI9.pdb.gz	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
8	AFDB:F1QK57	0.397	0.133	1.501E-28	2201	0.159	0.050	F1QK57.pdb.gz
9	AFDB:E9Q0B5	0.403	0.120	1.974E-28	2583	0.166	0.044	E9Q0B5.pdb.gz	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
10	AFDB:A0A0G2K8X5	0.412	0.289	2.746E-27	1032	0.161	0.107	A0A0G2K8X5.pdb.gz	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
11	PDB:2q7zA	0.048	0.029	6.012E-3	1931	0.091	0.032	2q7zA.pdb.gz
12	PDB:4ga9A	0.069	0.228	2.369E-2	134	0.029	0.149	4ga9A.pdb.gz	Gal-1 structure analysis
13	PDB:4pbpB	0.071	0.188	2.502E-2	210	0.025	0.081	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
14	PDB:5lj5t	0.066	0.088	2.644E-2	438	0.036	0.057	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
15	PDB:5dg2B	0.065	0.198	2.793E-2	131	0.028	0.145	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.
16	PDB:5wlcLV	0.083	0.125	3.292E-2	362	0.034	0.064	5wlcLV.pdb.gz	The complete structure of the small-subunit processome.
17	PDB:7rroe	0.077	0.083	4.100E-2	610	0.063	0.070	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:2i2aA	0.059	0.109	4.833E-2	264	0.020	0.053	2i2aA.pdb.gz	NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
19	PDB:6drtA	0.063	0.137	5.105E-2	230	0.028	0.083	6drtA.pdb.gz	T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.
20	PDB:6e20B	0.070	0.250	5.105E-2	133	0.028	0.143	6e20B.pdb.gz	Structure of the zebrafish galectin-1-L2 and model of its interaction with the infectious hematopoietic necrosis virus (IHNV) envelope glycoprotein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6H8K2	0.0	944	668	0.658	0.675	A6H8K2_DANRE BMP-binding endothelial regulator protein precursor OS=Danio rerio OX=7955 GN=cvl2 PE=2 SV=1
2	Q5D734	0.0	891	668	0.634	0.650	Q5D734_DANRE Crossveinless 2 OS=Danio rerio OX=7955 GN=cvl2 PE=1 SV=1
3	Q8CJ69	0.0	1316	685	0.927	0.927	BMPER_MOUSE BMP-binding endothelial regulator protein OS=Mus musculus OX=10090 GN=Bmper PE=1 SV=1
4	Q8N8U9	0.0	1397	685	1.000	1.000	BMPER_HUMAN BMP-binding endothelial regulator protein OS=Homo sapiens OX=9606 GN=BMPER PE=1 SV=3
5	Q9GYX3	3.85e-103	333	751	0.315	0.288	Q9GYX3_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
6	Q9W2H2	9.23e-102	329	751	0.315	0.288	Q9W2H2_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
7	Q3U492	1.56e-94	322	1550	0.323	0.143	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
8	Q8K0P6	6.65e-43	169	1205	0.191	0.109	Q8K0P6_MOUSE Fcgbp protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
9	O88799	1.39e-42	169	5376	0.171	0.022	ZAN_MOUSE Zonadhesin OS=Mus musculus OX=10090 GN=Zan PE=1 SV=1
10	E9Q0B5	3.71e-42	167	2583	0.191	0.051	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
11	E9Q9C6	3.81e-42	167	2583	0.191	0.051	E9Q9C6_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
12	Q9Y6R7	3.22e-41	164	5405	0.172	0.022	FCGBP_HUMAN IgGFc-binding protein OS=Homo sapiens OX=9606 GN=FCGBP PE=1 SV=3
13	Q9VU94	2.27e-40	162	3843	0.158	0.028	Q9VU94_DROME Hemolectin, isoform A OS=Drosophila melanogaster OX=7227 GN=Hml PE=1 SV=2
14	Q9U5D0	2.47e-40	162	3843	0.158	0.028	Q9U5D0_DROME Hemolectin OS=Drosophila melanogaster OX=7227 GN=Hml PE=2 SV=1
15	A2VEC9	2.52e-40	162	5150	0.216	0.029	SSPO_HUMAN SCO-spondin OS=Homo sapiens OX=9606 GN=SSPOP PE=2 SV=2
16	O75443	2.89e-40	161	2155	0.175	0.056	TECTA_HUMAN Alpha-tectorin OS=Homo sapiens OX=9606 GN=TECTA PE=1 SV=3
17	Q98UI9	3.00e-40	161	2108	0.232	0.075	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
18	M9PCE5	3.09e-40	161	3842	0.158	0.028	M9PCE5_DROME Hemolectin, isoform B OS=Drosophila melanogaster OX=7227 GN=Hml PE=1 SV=1
19	Q28983	6.19e-40	160	2476	0.171	0.047	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
20	O08523	1.11e-39	159	2155	0.172	0.055	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08742 C8	1.8e-14	65.1	C8 domain
2	PF01826 TIL	2.9e-07	41.9	Trypsin Inhibitor like cysteine rich domain
3	PF12714 TILa	14	17.0	TILa domain
4	PF00093 VWC	1.4e-19	81.4	von Willebrand factor type C domain
5	PF00094 VWD	4.3e-31	119.8	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297161

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368104	0.968	Bone morphogenetic protein 2
2	9606.ENSP00000204604	0.895	Chordin
3	9606.ENSP00000245451	0.884	Bone morphogenetic protein 4
4	9606.ENSP00000262120	0.769	Twisted gastrulation protein homolog 1
5	9606.ENSP00000243077	0.731	Prolow-density lipoprotein receptor-related protein 1
6	9606.ENSP00000305334	0.708	Follistatin-related protein 5
7	9606.ENSP00000283147	0.702	Bone morphogenetic protein 6
8	9606.ENSP00000304930	0.694	Sclerostin domain-containing protein 1
9	9606.ENSP00000242208	0.671	Inhibin beta A chain
10	9606.ENSP00000478319	0.643	Gremlin-1
11	9606.ENSP00000301691	0.635	Sclerostin
12	9606.ENSP00000379204	0.632	Bone morphogenetic protein 7
13	9606.ENSP00000401907	0.632	Bone morphogenetic protein receptor type-1B
14	9606.ENSP00000256759	0.619	Follistatin
15	9606.ENSP00000005257	0.613	Ras-related protein Ral-A
16	9606.ENSP00000328181	0.588	Noggin
17	9606.ENSP00000061240	0.585	Tolloid-like protein 1
18	9606.ENSP00000463051	0.584	Growth/differentiation factor 2
19	9606.ENSP00000361107	0.578	Bone morphogenetic protein receptor type-1A
20	9606.ENSP00000340361	0.575	Activin receptor type-2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050840	0.435	extracellular matrix binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.988	anatomical structure development
GO:0050794	0.988	regulation of cellular process
GO:0032501	0.987	multicellular organismal process
GO:0009987	0.985	cellular process
GO:0007275	0.983	multicellular organism development
GO:0009966	0.981	regulation of signal transduction
GO:0050793	0.980	regulation of developmental process
GO:0051239	0.977	regulation of multicellular organismal process
GO:0009653	0.962	anatomical structure morphogenesis
GO:2000026	0.960	regulation of multicellular organismal development
GO:0048731	0.960	system development
GO:0048519	0.958	negative regulation of biological process
GO:0048523	0.954	negative regulation of cellular process
GO:0050896	0.952	response to stimulus
GO:0090287	0.945	regulation of cellular response to growth factor stimulus
GO:0090092	0.942	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030154	0.925	cell differentiation
GO:0035295	0.924	tube development
GO:0030510	0.911	regulation of BMP signaling pathway
GO:0019222	0.899	regulation of metabolic process
GO:0060255	0.890	regulation of macromolecule metabolic process
GO:0048513	0.889	animal organ development
GO:0080090	0.883	regulation of primary metabolic process
GO:0051171	0.883	regulation of nitrogen compound metabolic process
GO:1902533	0.878	positive regulation of intracellular signal transduction
GO:0031323	0.877	regulation of cellular metabolic process
GO:0009888	0.876	tissue development
GO:0090101	0.872	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090288	0.858	negative regulation of cellular response to growth factor stimulus
GO:0030514	0.854	negative regulation of BMP signaling pathway
GO:0048729	0.840	tissue morphogenesis
GO:1901342	0.823	regulation of vasculature development
GO:0051716	0.814	cellular response to stimulus
GO:0072359	0.802	circulatory system development
GO:0045765	0.771	regulation of angiogenesis
GO:0070848	0.764	response to growth factor
GO:0007154	0.758	cell communication
GO:0023052	0.757	signaling
GO:0007167	0.750	enzyme-linked receptor protein signaling pathway
GO:0001568	0.748	blood vessel development
GO:0060393	0.735	regulation of pathway-restricted SMAD protein phosphorylation
GO:0060429	0.723	epithelium development
GO:0035239	0.685	tube morphogenesis
GO:0007423	0.681	sensory organ development
GO:0051094	0.678	positive regulation of developmental process
GO:0071363	0.634	cellular response to growth factor stimulus
GO:0007178	0.624	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071772	0.605	response to BMP
GO:0071773	0.601	cellular response to BMP stimulus
GO:0048646	0.598	anatomical structure formation involved in morphogenesis
GO:0071704	0.587	organic substance metabolic process
GO:0030509	0.580	BMP signaling pathway
GO:0051240	0.550	positive regulation of multicellular organismal process
GO:0044238	0.467	primary metabolic process
GO:0044237	0.462	cellular metabolic process
GO:0009893	0.449	positive regulation of metabolic process
GO:0040012	0.442	regulation of locomotion
GO:0010604	0.441	positive regulation of macromolecule metabolic process
GO:0030334	0.429	regulation of cell migration
GO:0006807	0.420	nitrogen compound metabolic process
GO:0051173	0.408	positive regulation of nitrogen compound metabolic process
GO:0060562	0.398	epithelial tube morphogenesis
GO:0030097	0.383	hemopoiesis
GO:0045595	0.376	regulation of cell differentiation
GO:0010468	0.369	regulation of gene expression
GO:0043170	0.368	macromolecule metabolic process
GO:0031325	0.362	positive regulation of cellular metabolic process
GO:1901564	0.355	organonitrogen compound metabolic process
GO:0090100	0.355	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009889	0.338	regulation of biosynthetic process
GO:0010556	0.324	regulation of macromolecule biosynthetic process
GO:0031326	0.324	regulation of cellular biosynthetic process
GO:0003002	0.320	regionalization
GO:0019219	0.314	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0071944	0.999	cell periphery
GO:0031012	0.988	extracellular matrix
GO:0062023	0.441	collagen-containing extracellular matrix
GO:0005622	0.377	intracellular anatomical structure
GO:0043227	0.361	membrane-bounded organelle
GO:0043229	0.350	intracellular organelle
GO:0005737	0.344	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]