StarFunc result for job id Q8N8V2

User Input

>input (638 residues)
MASEIHMPGPVCLTENTKGHLVVNSEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KNKGFPLGCTVKSETKGIWMWCVPHPSKPNHTLILLDTEGLGDMEKSDPKSDSWIFALAV
LLSSSFVYNSMGTINHQALEQLHYVTELTELIRAKSCPRPDEVEDSSEFVSFFPDFIWTV
RDFTLELKLDGHPITEDEYLENALKLISGKNPQIQNSNKPREWIRHFFPKQKCFVFDRPI
NDKKLLLHVEEVREDQLDSNFQMQSENFCSYIFTHAKTKTLREGILVTGNRLGMLVETYL
DAINSGATPCLENAMAVLAQCENSAAVQRAANHYSQQMAQQVRFPTDTLQELLDVHAVCE
REAIAVFMEYSFKDKSQEFQKKLVDTMEKKKEDFVLQNEEASAKYCQAELKRLSELLTES
ISRGTFFVPGGHNIYLEAKKKIEQDYTLVPRKGVKADEVLQSFLQSQVVIEESILQSDKA
LTAGEKAIAAKQAKKEAAEKEQELLRQKQKEQQQMMEAQERSFQENIAQLKKKMEREREN
YMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAAENEEPSVFSQILDVA
GSIFIAALPGAAKLVDLGMKILSSLCNRLRNPGKKIIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N8V2	1.000	1.000	7.430E-95	638	1.000	1.000	Q8N8V2.pdb.gz	GBP7_HUMAN Guanylate-binding protein 7 OS=Homo sapiens OX=9606 GN=GBP7 PE=1 SV=2
2	AFDB:Q96PP9	0.938	0.935	1.393E-74	640	0.754	0.752	Q96PP9.pdb.gz	GBP4_HUMAN Guanylate-binding protein 4 OS=Homo sapiens OX=9606 GN=GBP4 PE=1 SV=2
3	AFDB:Q6ZN66	0.946	0.953	2.893E-71	633	0.683	0.689	Q6ZN66.pdb.gz	GBP6_HUMAN Guanylate-binding protein 6 OS=Homo sapiens OX=9606 GN=GBP6 PE=1 SV=1
4	AFDB:Q91Z40	0.958	0.958	8.838E-71	638	0.679	0.679	Q91Z40.pdb.gz	GBP7_MOUSE Guanylate-binding protein 7 OS=Mus musculus OX=10090 GN=Gbp7 PE=1 SV=2
5	AFDB:Q61107	0.947	0.974	1.511E-70	620	0.682	0.702	Q61107.pdb.gz	GBP3_MOUSE Guanylate-binding protein 3 OS=Mus musculus OX=10090 GN=Gbp3 PE=1 SV=1
6	AFDB:Q6PG83	0.921	0.949	3.280E-67	619	0.614	0.633	Q6PG83.pdb.gz	Q6PG83_MOUSE cDNA sequence BC057170 OS=Mus musculus OX=10090 GN=Gbp9 PE=2 SV=1
7	AFDB:A0A0G2JDV3	0.912	0.951	1.828E-65	611	0.605	0.632	A0A0G2JDV3.pdb.gz	GBP6_MOUSE Guanylate-binding protein 6 OS=Mus musculus OX=10090 GN=Gbp6 PE=2 SV=2
8	AFDB:A4UUI3	0.902	0.911	2.313E-60	631	0.578	0.585	A4UUI3.pdb.gz	GBP4_MOUSE Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1
9	AFDB:B2XWS1	0.902	0.974	1.155E-59	590	0.502	0.542	B2XWS1.pdb.gz	B2XWS1_PIG Guanylate binding protein 1 OS=Sus scrofa OX=9823 GN=GBP1 PE=1 SV=1
10	AFDB:P32456	0.886	0.955	1.155E-59	591	0.513	0.553	P32456.pdb.gz	GBP2_HUMAN Guanylate-binding protein 2 OS=Homo sapiens OX=9606 GN=GBP2 PE=1 SV=3
11	PDB:7m1sA	0.834	0.917	1.437E-50	577	0.506	0.560	7m1sA.pdb.gz
12	PDB:6k1zA	0.803	0.937	4.899E-49	544	0.475	0.557	6k1zA.pdb.gz	Structural mechanism for guanylate-binding proteins (GBPs) targeting by the Shigella E3 ligase IpaH9.8.
13	PDB:6lojB	0.841	0.936	6.834E-48	571	0.494	0.552	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.
14	PDB:3x1dA	0.388	0.596	4.040E-10	381	0.122	0.205	3x1dA.pdb.gz	Comparison of human and Drosophila atlastin GTPases
15	PDB:3zjcE	0.218	0.412	1.400E-5	286	0.069	0.154	3zjcE.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
16	PDB:7pw4C	0.302	0.581	1.673E-5	310	0.067	0.139	7pw4C.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
17	PDB:3zjcF	0.210	0.442	2.919E-4	252	0.060	0.151	3zjcF.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
18	PDB:1wf3A	0.167	0.331	7.457E-4	296	0.056	0.122	1wf3A.pdb.gz	Crystal structure of GTP-binding protein TT1341 from Thermus thermophilus HB8
19	PDB:1ob2A	0.195	0.295	1.457E-3	393	0.039	0.064	1ob2A.pdb.gz	Kirromycin Defines a Specific Domain Arrangement of Elongation Factor EF-TU
20	PDB:1vg8A	0.157	0.434	1.992E-3	184	0.053	0.185	1vg8A.pdb.gz	Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JDV3	790	611	0.602	0.628	GBP6_MOUSE Guanylate-binding protein 6 OS=Mus musculus OX=10090 GN=Gbp6 PE=2 SV=2
2	A4UUI3	707	631	0.567	0.574	GBP4_MOUSE Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1
3	B2XWS1	650	590	0.505	0.546	B2XWS1_PIG Guanylate binding protein 1 OS=Sus scrofa OX=9823 GN=GBP1 PE=1 SV=1
4	I6L9A3	578	385	0.415	0.688	I6L9A3_MOUSE 5830443L24Rik protein OS=Mus musculus OX=10090 GN=Gbp8 PE=2 SV=1
5	L7N1X8	793	611	0.607	0.633	L7N1X8_MOUSE Predicted gene 43302 OS=Mus musculus OX=10090 GN=Gm43302 PE=3 SV=2
6	P32455	667	592	0.508	0.547	GBP1_HUMAN Guanylate-binding protein 1 OS=Homo sapiens OX=9606 GN=GBP1 PE=1 SV=2
7	P32456	668	591	0.511	0.552	GBP2_HUMAN Guanylate-binding protein 2 OS=Homo sapiens OX=9606 GN=GBP2 PE=1 SV=3
8	Q000W5	782	611	0.597	0.624	Q000W5_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
9	Q01514	622	589	0.486	0.526	GBP1_MOUSE Guanylate-binding protein 1 OS=Mus musculus OX=10090 GN=Gbp1 PE=1 SV=1
10	Q29RG2	783	611	0.597	0.624	Q29RG2_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
11	Q2M1J9	782	611	0.597	0.624	Q2M1J9_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
12	Q5DTF3	702	606	0.538	0.566	Q5DTF3_MOUSE MKIAA4245 protein (Fragment) OS=Mus musculus OX=10090 GN=Gbp4 PE=2 SV=1
13	Q61107	905	620	0.682	0.702	GBP3_MOUSE Guanylate-binding protein 3 OS=Mus musculus OX=10090 GN=Gbp3 PE=1 SV=1
14	Q6PG83	793	619	0.618	0.637	Q6PG83_MOUSE cDNA sequence BC057170 OS=Mus musculus OX=10090 GN=Gbp9 PE=2 SV=1
15	Q6ZN66	872	633	0.685	0.690	GBP6_HUMAN Guanylate-binding protein 6 OS=Homo sapiens OX=9606 GN=GBP6 PE=1 SV=1
16	Q8BTS3	792	619	0.616	0.635	Q8BTS3_MOUSE Guanylate-binding protein 9 OS=Mus musculus OX=10090 GN=Gbp9 PE=1 SV=1
17	Q8CFB4	555	590	0.431	0.466	GBP5_MOUSE Guanylate-binding protein 5 OS=Mus musculus OX=10090 GN=Gbp5 PE=1 SV=2
18	Q8N8V2	1321	638	1.000	1.000	GBP7_HUMAN Guanylate-binding protein 7 OS=Homo sapiens OX=9606 GN=GBP7 PE=1 SV=2
19	Q91Z40	900	638	0.680	0.680	GBP7_MOUSE Guanylate-binding protein 7 OS=Mus musculus OX=10090 GN=Gbp7 PE=1 SV=2
20	Q96PP8	598	586	0.481	0.524	GBP5_HUMAN Guanylate-binding protein 5 OS=Homo sapiens OX=9606 GN=GBP5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01442 Apolipoprotein	3.7e+02	12.3	Apolipoprotein A1/A4/E domain
2	PF09769 ApoO	8.8e+02	11.2	Apolipoprotein O
3	PF02263 GBP	3.9e-123	421.4	Guanylate-binding protein, N-terminal domain
4	PF02841 GBP_C	2.3e-119	409.8	Guanylate-binding protein, C-terminal domain
5	PF01926 MMR_HSR1	21	16.6	50S ribosome-binding GTPase
6	PF05879 RHD3_GTPase	2	19.3	Root hair defective 3 GTP-binding protein (RHD3) GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294671

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384259	0.808	Cysteine protease ATG4B
2	9606.ENSP00000435460	0.639	Galectin 8
3	9606.ENSP00000367851	0.574	Cytochrome b-245 heavy chain
4	9606.ENSP00000428220	0.574	Immunity-related GTPase family M protein
5	9606.ENSP00000356505	0.566	Neutrophil cytosol factor 2
6	9606.ENSP00000261623	0.536	Cytochrome b-245 light chain
7	9606.ENSP00000245414	0.504	Interferon regulatory factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.992	protein binding
GO:0042802	0.836	identical protein binding
GO:0046983	0.816	protein dimerization activity
GO:0042803	0.716	protein homodimerization activity
GO:0003824	0.619	catalytic activity
GO:0016787	0.434	hydrolase activity
GO:1901363	0.392	heterocyclic compound binding
GO:0097159	0.392	organic cyclic compound binding
GO:0003924	0.327	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0098542	0.988	defense response to other organism
GO:0051716	0.985	cellular response to stimulus
GO:0050789	0.979	regulation of biological process
GO:0050794	0.965	regulation of cellular process
GO:0071345	0.950	cellular response to cytokine stimulus
GO:0045087	0.940	innate immune response
GO:0048519	0.928	negative regulation of biological process
GO:0034341	0.914	response to type II interferon
GO:0032479	0.901	regulation of type I interferon production
GO:0071346	0.895	cellular response to type II interferon
GO:0048583	0.742	regulation of response to stimulus
GO:0048523	0.742	negative regulation of cellular process
GO:0048518	0.698	positive regulation of biological process
GO:0009892	0.659	negative regulation of metabolic process
GO:0001818	0.631	negative regulation of cytokine production
GO:0031323	0.578	regulation of cellular metabolic process
GO:0051171	0.570	regulation of nitrogen compound metabolic process
GO:0080090	0.545	regulation of primary metabolic process
GO:0009615	0.489	response to virus
GO:0002831	0.437	regulation of response to biotic stimulus
GO:0080134	0.432	regulation of response to stress
GO:0140546	0.432	defense response to symbiont
GO:0032101	0.431	regulation of response to external stimulus
GO:0031347	0.422	regulation of defense response
GO:0010646	0.405	regulation of cell communication
GO:0023051	0.381	regulation of signaling
GO:0032480	0.376	negative regulation of type I interferon production
GO:0009966	0.351	regulation of signal transduction
GO:0051607	0.350	defense response to virus
GO:0009617	0.330	response to bacterium
GO:0019219	0.322	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.321	regulation of biosynthetic process
GO:0048522	0.309	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031982	0.998	vesicle
GO:0031410	0.990	cytoplasmic vesicle
GO:0005576	0.962	extracellular region
GO:0005829	0.962	cytosol
GO:0065010	0.850	extracellular membrane-bounded organelle
GO:0033655	0.788	host cell cytoplasm part
GO:0020003	0.779	symbiont-containing vacuole
GO:0016020	0.765	membrane
GO:0020005	0.751	symbiont-containing vacuole membrane
GO:0012505	0.468	endomembrane system
GO:0071944	0.348	cell periphery
GO:0005634	0.305	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.434	Hydrolases.
RHEA:19669	0.327	GTP + H2O = GDP + H(+) + phosphate

[back to server]