StarFunc result for job id Q8N907

User Input

>input (189 residues)
MLLGQLSTLLCLLSGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSW
KAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRL
RNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLI
EGCHCSPKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q76LW6	0.718	0.732	1.601E-19	185	0.619	0.632	Q76LW6.pdb.gz	DAND5_MOUSE DAN domain family member 5 OS=Mus musculus OX=10090 GN=Dand5 PE=2 SV=1
2	AFDB:Q9PUK2	0.478	0.340	4.452E-9	272	0.265	0.184	Q9PUK2.pdb.gz	Q9PUK2_CHICK Caronte OS=Gallus gallus OX=9031 GN=CAR PE=2 SV=1
3	AFDB:A8E7M9	0.483	0.380	4.969E-9	243	0.233	0.181	A8E7M9.pdb.gz
4	AFDB:Q800X4	0.482	0.422	1.074E-8	217	0.296	0.258	Q800X4.pdb.gz	DAND5_XENLA DAN domain family member 5 OS=Xenopus laevis OX=8355 GN=dand5 PE=1 SV=1
5	AFDB:O95813	0.423	0.304	9.703E-8	267	0.249	0.176	O95813.pdb.gz	CER1_HUMAN Cerberus OS=Homo sapiens OX=9606 GN=CER1 PE=1 SV=1
6	AFDB:P70041	0.432	0.307	1.682E-7	270	0.217	0.152	P70041.pdb.gz	CER1_XENLA Cerberus OS=Xenopus laevis OX=8355 GN=cer1 PE=1 SV=1
7	AFDB:O55233	0.438	0.318	5.057E-7	272	0.212	0.147	O55233.pdb.gz	CER1_MOUSE Cerberus OS=Mus musculus OX=10090 GN=Cer1 PE=1 SV=1
8	AFDB:Q9VD83	0.440	0.478	9.263E-7	173	0.159	0.173	Q9VD83.pdb.gz	BURS_DROME Bursicon OS=Drosophila melanogaster OX=7227 GN=Burs PE=1 SV=1
9	AFDB:P41271	0.448	0.467	9.788E-7	181	0.185	0.193	P41271.pdb.gz	NBL1_HUMAN Neuroblastoma suppressor of tumorigenicity 1 OS=Homo sapiens OX=9606 GN=NBL1 PE=1 SV=2
10	AFDB:Q6NZ13	0.446	0.460	9.788E-7	183	0.190	0.197	Q6NZ13.pdb.gz	NBL1_DANRE Neuroblastoma suppressor of tumorigenicity 1 OS=Danio rerio OX=7955 GN=nbl1 PE=2 SV=1
11	PDB:5hk5F	0.412	0.576	4.063E-6	129	0.164	0.240	5hk5F.pdb.gz
12	PDB:4my2A	0.374	0.159	1.054E-3	474	0.116	0.046	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
13	PDB:2k8pA	0.316	0.316	3.947E-3	189	0.169	0.169	2k8pA.pdb.gz
14	PDB:4mqwB	0.354	0.569	4.655E-3	109	0.079	0.138	4mqwB.pdb.gz
15	PDB:1hcnB	0.362	0.573	9.010E-3	110	0.085	0.145	1hcnB.pdb.gz
16	PDB:7t9iB	0.355	0.576	1.947E-2	109	0.085	0.147	7t9iB.pdb.gz
17	PDB:5nxsA	0.269	0.186	2.426E-2	290	0.101	0.066	5nxsA.pdb.gz
18	PDB:1wq8A	0.271	0.440	1.072E-1	100	0.063	0.120	1wq8A.pdb.gz
19	PDB:6xywAr	0.167	0.213	1.491E-1	137	0.090	0.124	6xywAr.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
20	PDB:1m4uA	0.309	0.295	1.964E-1	199	0.127	0.121	1m4uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q76LW6	3.86e-70	213	185	0.619	0.632	DAND5_MOUSE DAN domain family member 5 OS=Mus musculus OX=10090 GN=Dand5 PE=2 SV=1
2	Q76C29	5.15e-15	72.8	243	0.201	0.156	Q76C29_DANRE DAN domain family, member 5 precursor OS=Danio rerio OX=7955 GN=charon PE=2 SV=1
3	Q9PWB0	4.74e-14	70.5	272	0.169	0.118	CER1_CHICK Cerberus OS=Gallus gallus OX=9031 GN=CER1 PE=2 SV=1
4	Q9PUK2	5.51e-14	70.5	272	0.169	0.118	Q9PUK2_CHICK Caronte OS=Gallus gallus OX=9031 GN=CAR PE=2 SV=1
5	O95813	1.49e-13	68.9	267	0.228	0.161	CER1_HUMAN Cerberus OS=Homo sapiens OX=9606 GN=CER1 PE=1 SV=1
6	O55233	1.00e-10	61.2	272	0.175	0.121	CER1_MOUSE Cerberus OS=Mus musculus OX=10090 GN=Cer1 PE=1 SV=1
7	Q800X4	6.02e-10	58.5	217	0.159	0.138	DAND5_XENLA DAN domain family member 5 OS=Xenopus laevis OX=8355 GN=dand5 PE=1 SV=1
8	P41271	1.20e-08	54.3	181	0.164	0.171	NBL1_HUMAN Neuroblastoma suppressor of tumorigenicity 1 OS=Homo sapiens OX=9606 GN=NBL1 PE=1 SV=2
9	Q6NZ13	1.63e-08	53.9	183	0.164	0.169	NBL1_DANRE Neuroblastoma suppressor of tumorigenicity 1 OS=Danio rerio OX=7955 GN=nbl1 PE=2 SV=1
10	Q61477	2.35e-08	53.5	178	0.169	0.180	NBL1_MOUSE Neuroblastoma suppressor of tumorigenicity 1 OS=Mus musculus OX=10090 GN=Nbl1 PE=1 SV=2
11	Q90YC9	5.84e-08	52.4	177	0.159	0.169	NBL1_CHICK Neuroblastoma suppressor of tumorigenicity 1 OS=Gallus gallus OX=9031 GN=NBL1 PE=2 SV=2
12	P70041	8.90e-08	52.8	270	0.132	0.093	CER1_XENLA Cerberus OS=Xenopus laevis OX=8355 GN=cer1 PE=1 SV=1
13	O73753	2.84e-06	47.8	175	0.122	0.131	NBL1_XENLA Neuroblastoma suppressor of tumorigenicity 1 OS=Xenopus laevis OX=8355 GN=nbl1 PE=1 SV=1
14	R0KDQ4	2.21e-04	42.4	184	0.106	0.109	R0KDQ4_ANAPL Gremlin 1, DAN family BMP antagonist (Fragment) OS=Anas platyrhynchos OX=8839 GN=GREM1 PE=3 SV=1
15	Q9H772	2.48e-04	42.0	168	0.116	0.131	GREM2_HUMAN Gremlin-2 OS=Homo sapiens OX=9606 GN=GREM2 PE=1 SV=1
16	O88273	2.98e-04	42.0	168	0.116	0.131	GREM2_MOUSE Gremlin-2 OS=Mus musculus OX=10090 GN=Grem2 PE=1 SV=1
17	Q566Z5	3.42e-04	41.6	166	0.116	0.133	Q566Z5_DANRE Gremlin OS=Danio rerio OX=7955 GN=grem2 PE=2 SV=1
18	O73754	4.23e-04	41.6	182	0.106	0.110	GREM1_XENLA Gremlin-1 OS=Xenopus laevis OX=8355 GN=grem1 PE=2 SV=1
19	O60565	5.16e-04	41.2	184	0.106	0.109	GREM1_HUMAN Gremlin-1 OS=Homo sapiens OX=9606 GN=GREM1 PE=1 SV=1
20	O35793	5.96e-04	41.2	184	0.106	0.109	GREM1_RAT Gremlin-1 OS=Rattus norvegicus OX=10116 GN=Grem1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00007 Cys_knot	5.5	18.7	Cystine-knot domain
2	PF03045 DAN	1.4e-14	65.5	DAN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323155

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243349	0.945	Activin receptor type-1C
2	9606.ENSP00000442656	0.931	Activin receptor type-1B
3	9606.ENSP00000296145	0.927	Teratocarcinoma-derived growth factor 1
4	9606.ENSP00000259216	0.926	Cryptic protein
5	9606.ENSP00000340361	0.923	Activin receptor type-2B
6	9606.ENSP00000241416	0.902	Activin receptor type-2A
7	9606.ENSP00000287139	0.774	Nodal homolog
8	9606.ENSP00000355785	0.633	Left-right determination factor 2
9	9606.ENSP00000370297	0.630	Cerberus
10	9606.ENSP00000289672	0.614	Polycystic kidney disease protein 1-like 1
11	9606.ENSP00000280481	0.609	FRAS1-related extracellular matrix protein 2
12	9606.ENSP00000304169	0.608	Pituitary homeobox 2
13	9606.ENSP00000318650	0.605	Gremlin-2
14	9606.ENSP00000478319	0.578	Gremlin-1
15	9606.ENSP00000373620	0.548	60 kDa heat shock protein, mitochondrial
16	9606.ENSP00000272134	0.526	Left-right determination factor 1
17	9606.ENSP00000370546	0.522	Arylsulfatase D
18	9606.ENSP00000262442	0.504	Dynein heavy chain 9, axonemal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	1.000	receptor ligand activity
GO:0016015	0.691	morphogen activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.993	regulation of cellular process
GO:0007275	0.991	multicellular organism development
GO:0048519	0.985	negative regulation of biological process
GO:0048583	0.977	regulation of response to stimulus
GO:0009855	0.976	determination of bilateral symmetry
GO:0003002	0.973	regionalization
GO:0032925	0.967	regulation of activin receptor signaling pathway
GO:0048523	0.963	negative regulation of cellular process
GO:0007368	0.950	determination of left/right symmetry
GO:0009987	0.888	cellular process
GO:0048731	0.881	system development
GO:0009968	0.840	negative regulation of signal transduction
GO:0007498	0.837	mesoderm development
GO:0030510	0.829	regulation of BMP signaling pathway
GO:0030514	0.823	negative regulation of BMP signaling pathway
GO:0048513	0.815	animal organ development
GO:0007507	0.780	heart development
GO:0048368	0.654	lateral mesoderm development
GO:0061371	0.645	determination of heart left/right asymmetry
GO:0050896	0.628	response to stimulus
GO:0003205	0.616	cardiac chamber development
GO:0003140	0.616	determination of left/right asymmetry in lateral mesoderm
GO:0019222	0.552	regulation of metabolic process
GO:0048518	0.522	positive regulation of biological process
GO:0051716	0.488	cellular response to stimulus
GO:0007154	0.457	cell communication
GO:0023052	0.455	signaling
GO:0007165	0.392	signal transduction
GO:0060255	0.370	regulation of macromolecule metabolic process
GO:0051239	0.356	regulation of multicellular organismal process
GO:0007178	0.318	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0050793	0.313	regulation of developmental process
GO:0048522	0.304	positive regulation of cellular process
GO:0003230	0.303	cardiac atrium development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.847	extracellular space
GO:0005622	0.738	intracellular anatomical structure
GO:0043226	0.705	organelle
GO:0005737	0.703	cytoplasm
GO:0043227	0.696	membrane-bounded organelle
GO:0016020	0.380	membrane
GO:0012505	0.301	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]