StarFunc result for job id Q8N960

User Input

>input (986 residues)
MVSKSDQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEI
DRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYT
KFKSEIQISIALETDTKPPVDSFKAKGAPPRDGKVPAILAGLDPRDIVAVLNEEGGYHQI
GPAEYCTDSFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLIN
PNFEPERASVRIRSSVEILRVYLALQSKLQIHLCCGDQSLGSTEIPLTGLLKKGSTEINQ
HPVTVEGAFTLDPPNRAKQKLAPIPVELAPTVGVSVALQREGIDSQSLIELKTQNEHEPE
HSKKKVLTPIKEKTLTGPKSPTVSPVPSHNQSPPTKDDATESEVESLQYDKDTKPNPKAS
SSVPASLAQLVTTSNASEVASGQKIAVPATSHHFCFSIDLRSIHALEIGFPINCILRYSY
PFFGSAAPIMTNPPVEVRKNMEVFLPQSYCAFDFATMPHQLQDTFLRIPLLVELWHKDKM
SKDLLLGIARIQLSNILSSEKTRFLGSNGEQCWRQTYSESVPVIAAQGSNNRIADLSYTV
TLEDYGLVKMREIFISDSSQGVSAVQQKPSSLPPAPCPSEIQTEPRETLEYKAALELEMW
KEMQEDIFENQLKQKELAHMQALAEEWKKRDRERESLVKKKVAEYTILEGKLQKTLIDLE
KREQQLASVESELQREKKELQSERQRNLQELQDSIRRAKEDCIHQVELERLKIKQLEEDK
HRLQQQLNDAENKYKILEKEFQQFKDQQNNKPEIRLQSEINLLTLEKVELERKLESATKS
KLHYKQQWGRALKELARLKQREQESQMARLKKQQEELEQMRLRYLAAEEKDTVKTERQEL
LDIRNELNRLRQQEQKQYQDSTEIASGKKDGPHGSVLEEGLDDYLTRLIEERDTLMRTGV
YNHEDRIISELDRQIREILAKSNASN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TSG1	0.326	0.325	0.000	988	0.896	0.894	Q7TSG1.pdb.gz	CE120_MOUSE Centrosomal protein of 120 kDa OS=Mus musculus OX=10090 GN=Cep120 PE=1 SV=1
2	AFDB:Q8N960	1.000	1.000	0.000	986	1.000	1.000	Q8N960.pdb.gz	CE120_HUMAN Centrosomal protein of 120 kDa OS=Homo sapiens OX=9606 GN=CEP120 PE=1 SV=2
3	AFDB:E7EZ44	0.211	0.218	5.339E-99	929	0.573	0.608	E7EZ44.pdb.gz
4	AFDB:Q6DN12	0.152	0.166	3.100E-15	878	0.061	0.068	Q6DN12.pdb.gz	MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MCTP2 PE=1 SV=3
5	AFDB:Q6DN14	0.124	0.123	4.457E-15	999	0.077	0.076	Q6DN14.pdb.gz	MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MCTP1 PE=2 SV=2
6	AFDB:Q9ESD7	0.135	0.070	1.439E-13	2090	0.073	0.034	Q9ESD7.pdb.gz	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
7	AFDB:Q3ULW6	0.100	0.100	4.458E-10	985	0.129	0.129	Q3ULW6.pdb.gz	CCD33_MOUSE Coiled-coil domain-containing protein 33 OS=Mus musculus OX=10090 GN=Ccdc33 PE=2 SV=2
8	PDB:5iz5A	0.111	0.142	5.503E-10	757	0.041	0.053	5iz5A.pdb.gz
9	PDB:5ixcA	0.112	0.157	2.012E-9	684	0.042	0.060	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
10	PDB:5iz5B	0.115	0.150	2.351E-9	746	0.041	0.054	5iz5B.pdb.gz
11	PDB:5izrC	0.107	0.155	2.834E-8	659	0.037	0.055	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
12	PDB:1cjyA	0.114	0.173	5.172E-7	633	0.017	0.027	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	AFDB:B3RH40	0.102	0.082	1.455E-6	1255	0.116	0.091	B3RH40.pdb.gz	B3RH40_MEDTR Myosin heavy chain-like protein, putative OS=Medicago truncatula OX=3880 GN=25484843 PE=4 SV=1
14	PDB:4rj9A	0.105	0.553	1.619E-6	161	0.028	0.174	4rj9A.pdb.gz
15	AFDB:Q581A4	0.106	0.138	1.986E-6	741	0.019	0.026	Q581A4.pdb.gz	Q581A4_TRYB2 C2 NT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10J17.430 PE=4 SV=1
16	PDB:5a52A	0.101	0.575	1.992E-6	154	0.023	0.149	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:5a50A	0.108	0.579	7.672E-6	165	0.018	0.109	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:6kxkD	0.104	0.174	1.506E-5	553	0.037	0.065	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
19	PDB:3nsjA	0.102	0.184	3.277E-5	530	0.016	0.030	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
20	AFDB:Q57VI6	0.136	0.278	1.325E-4	426	0.086	0.200	Q57VI6.pdb.gz	Q57VI6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.2F2.570 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TSG1	0.0	1775	988	0.894	0.892	CE120_MOUSE Centrosomal protein of 120 kDa OS=Mus musculus OX=10090 GN=Cep120 PE=1 SV=1
2	Q8N960	0.0	2023	986	1.000	1.000	CE120_HUMAN Centrosomal protein of 120 kDa OS=Homo sapiens OX=9606 GN=CEP120 PE=1 SV=2
3	Q57VI6	1.88e-11	69.7	426	0.068	0.157	Q57VI6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.2F2.570 PE=4 SV=1
4	A0A068FIK2	7.22e-05	49.3	1033	0.064	0.061	KN4A_GOSHI Kinesin-like protein KIN-4A OS=Gossypium hirsutum OX=3635 GN=KIN4A PE=2 SV=1
5	Q384D6	9.61e-05	48.5	558	0.061	0.108	Q384D6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0650 PE=4 SV=1
6	O01583	0.022	41.2	1592	0.053	0.033	MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans OX=6239 GN=mrck-1 PE=1 SV=3
7	Q38FE6	0.11	38.9	704	0.064	0.089	Q38FE6_TRYB2 Translin-associated factor X-interacting protein 1 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2470 PE=4 SV=1
8	Q96M89	0.14	38.5	665	0.049	0.072	CC138_HUMAN Coiled-coil domain-containing protein 138 OS=Homo sapiens OX=9606 GN=CCDC138 PE=1 SV=1
9	A2A870	0.47	37.0	1173	0.055	0.046	FBF1_MOUSE Fas-binding factor 1 OS=Mus musculus OX=10090 GN=Fbf1 PE=1 SV=1
10	Q86YS3	0.76	36.2	637	0.031	0.049	RFIP4_HUMAN Rab11 family-interacting protein 4 OS=Homo sapiens OX=9606 GN=RAB11FIP4 PE=1 SV=1
11	Q9Y2F5	0.79	36.2	2266	0.044	0.019	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
12	Q9D0F1	0.91	35.8	642	0.067	0.103	NDC80_MOUSE Kinetochore protein NDC80 homolog OS=Mus musculus OX=10090 GN=Ndc80 PE=1 SV=1
13	Q9QYE6	0.97	35.8	729	0.043	0.058	GOGA5_MOUSE Golgin subfamily A member 5 OS=Mus musculus OX=10090 GN=Golga5 PE=1 SV=2
14	F4IJK6	1.0	35.8	1083	0.055	0.050	KN14R_ARATH Kinesin-like protein KIN-14R OS=Arabidopsis thaliana OX=3702 GN=KIN14R PE=3 SV=1
15	Q8INC3	1.1	35.8	2194	0.075	0.034	Q8INC3_DROME Myosin heavy chain-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=2
16	A0A8I5Y6T0	1.2	35.4	1008	0.059	0.058	A0A8I5Y6T0_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=1 SV=1
17	G3V8Y8	1.4	35.4	1038	0.059	0.056	G3V8Y8_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=3 SV=2
18	Q9PTG8	1.4	35.4	931	0.045	0.047	TACC3_XENLA Transforming acidic coiled-coil-containing protein 3 OS=Xenopus laevis OX=8355 GN=tacc3 PE=1 SV=2
19	Q9VEZ0	1.6	35.4	2148	0.075	0.034	Q9VEZ0_DROME Myosin heavy chain-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=3
20	Q0KI67	1.7	35.0	2160	0.075	0.034	Q0KI67_DROME Myosin heavy chain-like, isoform G OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	1.1e-05	36.9	C2 domain
2	PF12416 DUF3668	4.5e-93	322.8	Cep120 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303058

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295872	0.974	Spindle and centriole-associated protein 1
2	9606.ENSP00000346359	0.903	Protein TALPID3
3	9606.ENSP00000326550	0.829	Transforming acidic coiled-coil-containing protein 3
4	9606.ENSP00000432768	0.828	Cytoskeleton-associated protein 5
5	9606.ENSP00000321703	0.816	Transforming acidic coiled-coil-containing protein 1
6	9606.ENSP00000257287	0.787	Centrosomal protein of 135 kDa
7	9606.ENSP00000410216	0.764	Centrosomal protein POC5
8	9606.ENSP00000356379	0.740	Abnormal spindle-like microcephaly-associated protein
9	9606.ENSP00000370337	0.739	Centrosomal protein of 152 kDa
10	9606.ENSP00000278935	0.735	Centrosomal protein of 164 kDa
11	9606.ENSP00000379643	0.730	Nuclear distribution protein nudE homolog 1
12	9606.ENSP00000287482	0.728	Spindle assembly abnormal protein 6 homolog
13	9606.ENSP00000334379	0.728	C2 domain-containing protein 3
14	9606.ENSP00000369614	0.727	Centrobin
15	9606.ENSP00000371308	0.723	Centromere protein J
16	9606.ENSP00000370803	0.696	Centriolar coiled-coil protein of 110 kDa
17	9606.ENSP00000316681	0.695	Centrosomal protein of 295 kDa
18	9606.ENSP00000389427	0.681	Centrosomal protein 44
19	9606.ENSP00000262210	0.677	Centrosome and spindle pole-associated protein 1
20	9606.ENSP00000342510	0.675	Centrosomal protein of 97 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051130	0.981	positive regulation of cellular component organization
GO:1902115	0.980	regulation of organelle assembly
GO:0010824	0.975	regulation of centrosome duplication
GO:0032880	0.973	regulation of protein localization
GO:0090068	0.957	positive regulation of cell cycle process
GO:0010638	0.957	positive regulation of organelle organization
GO:0044089	0.956	positive regulation of cellular component biogenesis
GO:0009987	0.951	cellular process
GO:1902117	0.949	positive regulation of organelle assembly
GO:0006996	0.939	organelle organization
GO:0051493	0.868	regulation of cytoskeleton organization
GO:0007017	0.597	microtubule-based process
GO:0022607	0.455	cellular component assembly
GO:0051495	0.431	positive regulation of cytoskeleton organization
GO:0000226	0.418	microtubule cytoskeleton organization
GO:0051179	0.387	localization
GO:0022402	0.377	cell cycle process
GO:0007098	0.369	centrosome cycle
GO:0070925	0.354	organelle assembly
GO:1903829	0.339	positive regulation of protein localization
GO:0044782	0.330	cilium organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	0.998	centrosome
GO:0005829	0.949	cytosol
GO:0005814	0.860	centriole
GO:0043227	0.822	membrane-bounded organelle
GO:0070013	0.439	intracellular organelle lumen
GO:0031981	0.421	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]