StarFunc result for job id Q8N967

User Input

>input (370 residues)
MLAPGSSPGQRGRLALQWRQVSWITCWIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLT
TVPPDVPAATRTLLLLNNKLSALPSWAFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTE
LQLRNNSIRTLDRDLLRHSPLLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLD
RLTFEPLANLQLLQVGDNPWECDCNLREFKHWMEWFSYRGGRLDQLACTLPKELRGKDMR
MVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPKPGAEPEPEPSTACPQKQRHR
PASVRRAMGTVIIAGVVCGVVCIMMVVAAAYGCIYASLMAKYHRELKKRQPLMGDPEGEH
EDQKQISSVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BGX3	0.887	0.887	2.870E-56	370	0.922	0.922	Q8BGX3.pdb.gz	LRTM2_MOUSE Leucine-rich repeat and transmembrane domain-containing protein 2 OS=Mus musculus OX=10090 GN=Lrtm2 PE=2 SV=1
2	AFDB:Q9HBL6	0.583	0.625	3.960E-24	345	0.343	0.368	Q9HBL6.pdb.gz	LRTM1_HUMAN Leucine-rich repeat and transmembrane domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRTM1 PE=1 SV=1
3	AFDB:Q8BXQ3	0.602	0.625	5.166E-24	356	0.330	0.343	Q8BXQ3.pdb.gz	LRTM1_MOUSE Leucine-rich repeat and transmembrane domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lrtm1 PE=2 SV=1
4	AFDB:Q99M75	0.409	0.336	8.044E-18	473	0.235	0.184	Q99M75.pdb.gz	RTN4R_RAT Reticulon-4 receptor OS=Rattus norvegicus OX=10116 GN=Rtn4r PE=1 SV=2
5	AFDB:F1QA76	0.396	0.336	4.123E-16	457	0.222	0.179	F1QA76.pdb.gz
6	AFDB:F1R4D3	0.288	0.208	4.837E-16	542	0.241	0.164	F1R4D3.pdb.gz	F1R4D3_DANRE Leucine-rich repeat transmembrane neuronal 2 OS=Danio rerio OX=7955 GN=lrrtm2 PE=1 SV=1
7	AFDB:Q8BZ81	0.340	0.235	5.101E-16	582	0.249	0.158	Q8BZ81.pdb.gz	LRRT3_MOUSE Leucine-rich repeat transmembrane neuronal protein 3 OS=Mus musculus OX=10090 GN=Lrrtm3 PE=2 SV=2
8	AFDB:Q9BZR6	0.401	0.331	1.074E-15	473	0.243	0.190	Q9BZR6.pdb.gz	RTN4R_HUMAN Reticulon-4 receptor OS=Homo sapiens OX=9606 GN=RTN4R PE=1 SV=1
9	AFDB:Q8C110	0.505	0.241	1.260E-15	840	0.211	0.093	Q8C110.pdb.gz	SLIK6_MOUSE SLIT and NTRK-like protein 6 OS=Mus musculus OX=10090 GN=Slitrk6 PE=1 SV=1
10	AFDB:B8JKM0	0.351	0.252	1.329E-15	524	0.249	0.176	B8JKM0.pdb.gz	B8JKM0_DANRE Leucine-rich repeat transmembrane neuronal 1 OS=Danio rerio OX=7955 GN=lrrtm1 PE=1 SV=1
11	PDB:5y31B	0.387	0.292	2.801E-10	511	0.124	0.090	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
12	PDB:1xcdA	0.211	0.254	1.291E-8	305	0.170	0.207	1xcdA.pdb.gz
13	PDB:2ft3F	0.373	0.445	9.749E-8	305	0.149	0.180	2ft3F.pdb.gz
14	PDB:5yq5B	0.351	0.416	1.750E-7	306	0.119	0.144	5yq5B.pdb.gz
15	PDB:7wv3A	0.257	0.154	1.947E-7	668	0.165	0.091	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
16	PDB:6gffI	0.369	0.258	2.134E-6	551	0.168	0.113	6gffI.pdb.gz
17	PDB:7wrqA	0.365	0.249	3.632E-6	566	0.178	0.117	7wrqA.pdb.gz
18	PDB:6hkwA	0.314	0.367	7.649E-6	306	0.132	0.160	6hkwA.pdb.gz
19	PDB:3t6qA	0.367	0.242	9.464E-6	601	0.130	0.080	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
20	PDB:3b2dA	0.386	0.251	9.981E-6	601	0.116	0.072	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BGX3	0.0	659	370	0.922	0.922	LRTM2_MOUSE Leucine-rich repeat and transmembrane domain-containing protein 2 OS=Mus musculus OX=10090 GN=Lrtm2 PE=2 SV=1
2	Q9HBL6	2.81e-60	199	345	0.324	0.348	LRTM1_HUMAN Leucine-rich repeat and transmembrane domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRTM1 PE=1 SV=1
3	Q8BXQ3	3.35e-56	189	356	0.311	0.323	LRTM1_MOUSE Leucine-rich repeat and transmembrane domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lrtm1 PE=2 SV=1
4	Q6ZSA7	2.15e-29	117	298	0.219	0.272	LRC55_HUMAN Leucine-rich repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=LRRC55 PE=1 SV=3
5	Q6GU68	6.54e-27	112	428	0.205	0.178	ISLR_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein OS=Mus musculus OX=10090 GN=Islr PE=1 SV=1
6	O14498	1.82e-25	108	428	0.192	0.166	ISLR_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein OS=Homo sapiens OX=9606 GN=ISLR PE=2 SV=1
7	G5EFX6	3.97e-24	106	1410	0.200	0.052	SLIT1_CAEEL Slit homolog 1 protein OS=Caenorhabditis elegans OX=6239 GN=slt-1 PE=1 SV=1
8	F1QF54	2.40e-23	103	715	0.208	0.108	F1QF54_DANRE Fibronectin leucine-rich transmembrane protein 1b OS=Danio rerio OX=7955 GN=flrt1b PE=1 SV=2
9	Q9DE36	4.38e-23	103	1512	0.214	0.052	Q9DE36_DANRE Slit homolog 2 protein precursor OS=Danio rerio OX=7955 GN=slit2 PE=1 SV=1
10	Q8TF66	1.06e-22	101	581	0.214	0.136	LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens OX=9606 GN=LRRC15 PE=1 SV=2
11	P24014	1.07e-22	102	1504	0.197	0.049	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
12	Q2I0M4	1.57e-22	99.0	334	0.203	0.225	LRC26_HUMAN Leucine-rich repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=LRRC26 PE=1 SV=2
13	Q9WVB4	2.09e-22	101	1523	0.184	0.045	SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus OX=10090 GN=Slit3 PE=2 SV=2
14	O88280	2.45e-22	101	1523	0.184	0.045	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
15	Q6WZD2	4.64e-22	99.4	478	0.254	0.197	Q6WZD2_DANRE Nogo receptor homolog 2a OS=Danio rerio OX=7955 GN=ngrh2a PE=2 SV=1
16	Q9WVC1	5.38e-22	100	766	0.200	0.097	SLIT2_RAT Slit homolog 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Slit2 PE=1 SV=3
17	Q9R1B9	6.77e-22	100	1521	0.200	0.049	SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus OX=10090 GN=Slit2 PE=2 SV=2
18	O94813	7.17e-22	99.8	1529	0.184	0.044	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
19	O75094	8.00e-22	99.8	1523	0.186	0.045	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
20	P70389	1.91e-21	98.2	603	0.189	0.116	ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus OX=10090 GN=Igfals PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01462 LRRNT	9.1e-05	33.3	Leucine rich repeat N-terminal domain
2	PF00560 LRR_1	7.4	18.3	Leucine Rich Repeat
3	PF12799 LRR_4	3.1e-06	38.6	Leucine Rich repeats (2 copies)
4	PF13306 LRR_5	0.0048	28.3	BspA type Leucine rich repeat region (6 copies)
5	PF13855 LRR_8	2.6e-20	83.3	Leucine rich repeat
6	PF16101 PRIMA1	28	16.2	Proline-rich membrane anchor 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000446278

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375067	0.639	Breast carcinoma-amplified sequence 3
2	9606.ENSP00000359892	0.625	Choline transporter-like protein 5
3	9606.ENSP00000357973	0.612	AFG1-like ATPase
4	9606.ENSP00000427211	0.612	Amyloid-beta A4 precursor protein-binding family B member 2
5	9606.ENSP00000479811	0.608	Contactin-associated protein-like 4
6	9606.ENSP00000372169	0.602	Voltage-dependent calcium channel subunit alpha-2/delta-4
7	9606.ENSP00000295452	0.585	Gamma-aminobutyric acid receptor subunit gamma-1
8	9606.ENSP00000322837	0.557	Transmembrane protein 40
9	9606.ENSP00000264436	0.549	Beta-adducin
10	9606.ENSP00000267807	0.537	Zinc finger protein 280D
11	9606.ENSP00000417583	0.535	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
12	9606.ENSP00000287907	0.520	5-hydroxytryptamine receptor 5A
13	9606.ENSP00000335592	0.520	Gamma-aminobutyric acid receptor subunit alpha-5
14	9606.ENSP00000322270	0.505	Adhesion G protein-coupled receptor L2
15	9606.ENSP00000260505	0.501	Tubulin polyglutamylase TTLL7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0044087	0.977	regulation of cellular component biogenesis
GO:0051094	0.956	positive regulation of developmental process
GO:0051128	0.953	regulation of cellular component organization
GO:0051239	0.929	regulation of multicellular organismal process
GO:1901888	0.909	regulation of cell junction assembly
GO:0050807	0.887	regulation of synapse organization
GO:0051963	0.878	regulation of synapse assembly
GO:0048522	0.875	positive regulation of cellular process
GO:0044089	0.868	positive regulation of cellular component biogenesis
GO:0051965	0.857	positive regulation of synapse assembly
GO:0009987	0.689	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.630	membrane-bounded organelle
GO:0030054	0.450	cell junction
GO:0045202	0.426	synapse
GO:0032991	0.320	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]