StarFunc result for job id Q8N9A8

User Input

>input (125 residues)
MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSF
FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP
RPHVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B8YCP3	0.975	0.975	1.477E-21	125	1.000	1.000	B8YCP3.pdb.gz	B8YCP3_HUMAN Nuclear envelope phosphatase-regulatory subunit 1 OS=Homo sapiens OX=9606 GN=FLJ38101 PE=2 SV=1
2	AFDB:A5PEW7	0.870	0.773	8.932E-9	142	0.360	0.317	A5PEW7.pdb.gz	A5PEW7_CAEEL Transmembrane protein 188 OS=Caenorhabditis elegans OX=6239 GN=nepr-1 PE=1 SV=1
3	AFDB:Q5LJU1	0.387	0.392	1.756E-3	123	0.328	0.333	Q5LJU1.pdb.gz	Q5LJU1_DROME Transmembrane protein 188 OS=Drosophila melanogaster OX=7227 GN=Cnep1r1 PE=2 SV=1
4	AFDB:Q9USQ0	0.618	0.452	1.993E-3	180	0.176	0.122	Q9USQ0.pdb.gz	SPO7_SCHPO Sporulation-specific protein spo7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spo7 PE=3 SV=1
5	AFDB:P18410	0.574	0.309	2.421E-1	259	0.104	0.050	P18410.pdb.gz	SPO7_YEAST Sporulation-specific protein SPO7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPO7 PE=1 SV=1
6	AFDB:O60127	0.333	0.331	8.039E-1	126	0.096	0.095	O60127.pdb.gz	PTF2_SCHPO Pdp3-interacting factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptf2 PE=1 SV=1
7	AFDB:P63389	0.493	0.114	1.251	637	0.112	0.022	P63389.pdb.gz	YHES_ECOLI Probable ATP-binding protein YheS OS=Escherichia coli (strain K12) OX=83333 GN=yheS PE=1 SV=1
8	AFDB:Q9VIV2	0.411	0.071	1.715	1062	0.112	0.013	Q9VIV2.pdb.gz	SWM_DROME Zinc finger protein swm OS=Drosophila melanogaster OX=7227 GN=swm PE=1 SV=1
9	PDB:7vgfA	0.344	0.105	2.436	550	0.080	0.018	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.
10	AFDB:Q9ET64	0.450	0.172	2.669	422	0.152	0.045	Q9ET64.pdb.gz	NSMA_RAT Sphingomyelin phosphodiesterase 2 OS=Rattus norvegicus OX=10116 GN=Smpd2 PE=1 SV=1
11	AFDB:Q38CC9	0.325	0.029	2.843	1798	0.136	0.009	Q38CC9.pdb.gz	Q38CC9_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6990 PE=3 SV=1
12	PDB:1f45B	0.187	0.177	2.944	133	0.112	0.105	1f45B.pdb.gz
13	PDB:6s1kE	0.370	0.427	2.944	102	0.072	0.088	6s1kE.pdb.gz
14	PDB:7kahE	0.196	0.186	3.340	138	0.120	0.109	7kahE.pdb.gz
15	PDB:4dk0A	0.340	0.165	3.558	324	0.072	0.028	4dk0A.pdb.gz
16	PDB:7vpkA	0.220	0.045	3.558	1055	0.064	0.008	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
17	PDB:1ohhG	0.358	0.453	4.880	94	0.056	0.074	1ohhG.pdb.gz	The Structure of Bovine F1-ATPase in Complex with its Regulatory Protein If1
18	PDB:3k29A	0.405	0.339	4.880	162	0.112	0.086	3k29A.pdb.gz
19	PDB:4d10H	0.132	0.101	5.198	173	0.064	0.046	4d10H.pdb.gz	Crystal Structure of the Human Cop9 Signalosome
20	PDB:1f6gA	0.210	0.178	5.897	160	0.208	0.163	1f6gA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8YCP3	6.83e-92	263	125	1.000	1.000	B8YCP3_HUMAN Nuclear envelope phosphatase-regulatory subunit 1 OS=Homo sapiens OX=9606 GN=FLJ38101 PE=2 SV=1
2	Q8N9A8	6.83e-92	263	125	1.000	1.000	NEPR1_HUMAN Nuclear envelope phosphatase-regulatory subunit 1 OS=Homo sapiens OX=9606 GN=CNEP1R1 PE=1 SV=1
3	H3BUT5	2.86e-65	194	93	0.744	1.000	H3BUT5_HUMAN Nuclear envelope phosphatase-regulatory subunit 1 OS=Homo sapiens OX=9606 GN=CNEP1R1 PE=1 SV=1
4	A5PEW7	3.13e-22	87.0	142	0.392	0.345	A5PEW7_CAEEL Transmembrane protein 188 OS=Caenorhabditis elegans OX=6239 GN=nepr-1 PE=1 SV=1
5	Q9XXN3	9.30e-21	83.2	140	0.376	0.336	NEPR1_CAEEL Nuclear envelope phosphatase-regulatory subunit 1 homolog OS=Caenorhabditis elegans OX=6239 GN=nepr-1 PE=3 SV=2
6	Q5LJU1	3.02e-14	66.2	123	0.312	0.317	Q5LJU1_DROME Transmembrane protein 188 OS=Drosophila melanogaster OX=7227 GN=Cnep1r1 PE=2 SV=1
7	Q563W7	0.87	31.2	1774	0.160	0.011	Q563W7_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=tct PE=2 SV=1
8	P40566	2.9	29.6	764	0.112	0.018	EGH1_YEAST Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
9	P19087	5.5	28.9	354	0.240	0.085	GNAT2_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-2 OS=Homo sapiens OX=9606 GN=GNAT2 PE=1 SV=4
10	Q5VYY2	6.8	28.5	423	0.128	0.038	LIPM_HUMAN Lipase member M OS=Homo sapiens OX=9606 GN=LIPM PE=2 SV=2
11	Q9LT15	7.2	28.5	514	0.208	0.051	STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana OX=3702 GN=STP10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12172 DUF35_N	2.4e+02	13.0	Rubredoxin-like zinc ribbon domain (DUF35_N)
2	PF17370 DUF5392	7.8e+02	11.6	Family of unknown function (DUF5392)
3	PF09771 Tmemb_18A	5e-53	189.9	Transmembrane protein 188

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010375059.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010375632.1	0.993	CTD nuclear envelope phosphatase 1
2	61622.XP_010368635.1	0.975	SHOC2, leucine rich repeat scaffold protein
3	61622.XP_010384280.1	0.961	Serine/threonine-protein phosphatase 4 regulatory subunit 2
4	61622.XP_010354177.1	0.942	TOX high mobility group box family member 4
5	61622.XP_010369480.1	0.942	Belongs to the PPP phosphatase family.
6	61622.XP_010377897.1	0.912	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
7	61622.XP_010364783.1	0.909	Belongs to the PPP phosphatase family.
8	61622.XP_010378937.1	0.891	Protein phosphatase 3 regulatory subunit B, alpha
9	61622.XP_010371396.1	0.887	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
10	61622.XP_010351750.1	0.867	Protein phosphatase 1 regulatory subunit 3B
11	61622.XP_010358250.1	0.866	Protein phosphatase 2 catalytic subunit alpha
12	61622.XP_010369172.1	0.866	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
13	61622.XP_010363201.1	0.833	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
14	61622.XP_010379694.1	0.833	Protein phosphatase 3 catalytic subunit alpha
15	61622.XP_010359224.1	0.832	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
16	61622.XP_010381953.1	0.805	Lipin 1
17	61622.XP_010385736.1	0.781	Serine/threonine-protein phosphatase 4 catalytic subunit
18	61622.XP_010356905.1	0.758	TOX high mobility group box family member 3
19	61622.XP_010351492.1	0.751	Lipin 2
20	61622.XP_010363118.1	0.741	Cytoplasmic protein NCK1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0048522	0.989	positive regulation of cellular process
GO:0080090	0.988	regulation of primary metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0009893	0.987	positive regulation of metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0035303	0.978	regulation of dephosphorylation
GO:0009889	0.975	regulation of biosynthetic process
GO:0031325	0.974	positive regulation of cellular metabolic process
GO:0051246	0.965	regulation of protein metabolic process
GO:0019216	0.957	regulation of lipid metabolic process
GO:0035304	0.949	regulation of protein dephosphorylation
GO:0051179	0.942	localization
GO:0035307	0.939	positive regulation of protein dephosphorylation
GO:0045834	0.927	positive regulation of lipid metabolic process
GO:0034504	0.897	protein localization to nucleus
GO:0046890	0.870	regulation of lipid biosynthetic process
GO:0009891	0.841	positive regulation of biosynthetic process
GO:0090207	0.827	regulation of triglyceride metabolic process
GO:0090208	0.726	positive regulation of triglyceride metabolic process
GO:0031326	0.705	regulation of cellular biosynthetic process
GO:0046889	0.676	positive regulation of lipid biosynthetic process
GO:0031328	0.536	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.982	protein-containing complex
GO:0043226	0.977	organelle
GO:0016020	0.973	membrane
GO:0043229	0.970	intracellular organelle
GO:0005634	0.959	nucleus
GO:0008287	0.927	protein serine/threonine phosphatase complex
GO:0012505	0.896	endomembrane system
GO:0031090	0.510	organelle membrane
GO:0042175	0.402	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031967	0.364	organelle envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]