StarFunc result for job id Q8N9B4

User Input

>input (389 residues)
MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHWLLWHGADITH
VTTRGWTASHIAAIRGQDACVQALIMNGANLTAQDDRGCTPLHLAATHGHSFTLQIMLRS
GVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCF
KFLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPG
HVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLIKMGADSNITN
KAGERPSDVAKRFAHLAAVKLLEELQKYDIDDENEIDENDVKYFIRHGVEGSTDAKDDLC
LSDLDKTDARRPSKNCRASWSMNDYVEKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1DRY3	0.490	0.249	6.701E-42	782	0.938	0.467	A1DRY3.pdb.gz	A1DRY3_HUMAN Several ankyrin repeat protein transcript variant 2 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:Q3V096	0.736	0.556	4.103E-40	527	0.781	0.577	Q3V096.pdb.gz	ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus OX=10090 GN=Ankrd42 PE=1 SV=1
3	AFDB:O70511	0.334	0.064	5.074E-15	2622	0.229	0.034	O70511.pdb.gz	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
4	AFDB:Q80YE7	0.387	0.118	8.486E-15	1442	0.213	0.058	Q80YE7.pdb.gz	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
5	AFDB:P97582	0.350	0.182	9.246E-15	843	0.237	0.109	P97582.pdb.gz	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
6	AFDB:Q9ET47	0.451	0.206	1.146E-14	871	0.239	0.107	Q9ET47.pdb.gz	ESPN_MOUSE Espin OS=Mus musculus OX=10090 GN=Espn PE=1 SV=2
7	AFDB:Q63618	0.453	0.215	1.419E-14	837	0.234	0.109	Q63618.pdb.gz	ESPN_RAT Espin OS=Rattus norvegicus OX=10116 GN=Espn PE=1 SV=2
8	AFDB:Q9NCP8	0.394	0.143	1.759E-14	1159	0.239	0.080	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
9	AFDB:B0S4T8	0.450	0.123	2.274E-14	1476	0.257	0.068	B0S4T8.pdb.gz
10	AFDB:Q54KA7	0.448	0.182	3.070E-14	986	0.237	0.093	Q54KA7.pdb.gz	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
11	PDB:8cs9A	0.450	0.224	5.390E-14	796	0.193	0.094	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:4oauC	0.446	0.259	5.128E-11	692	0.185	0.104	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
13	PDB:5vkqA	0.457	0.122	1.317E-10	1499	0.180	0.047	5vkqA.pdb.gz
14	PDB:2dvwA	0.334	0.554	3.239E-10	229	0.159	0.271	2dvwA.pdb.gz
15	PDB:1wg0A	0.325	0.509	3.462E-8	243	0.129	0.206	1wg0A.pdb.gz
16	PDB:6aunA	0.359	0.234	4.878E-8	618	0.180	0.113	6aunA.pdb.gz
17	PDB:6v9hC	0.361	0.513	5.790E-8	270	0.149	0.215	6v9hC.pdb.gz
18	PDB:1bu9A	0.362	0.782	3.216E-7	168	0.129	0.298	1bu9A.pdb.gz
19	PDB:6pqpA	0.366	0.234	3.503E-7	615	0.139	0.088	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:6jd6B	0.391	0.755	8.618E-7	192	0.100	0.203	6jd6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1DRY3	0.0	754	782	0.949	0.472	A1DRY3_HUMAN Several ankyrin repeat protein transcript variant 2 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
2	Q3V096	0.0	635	527	0.789	0.583	ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus OX=10090 GN=Ankrd42 PE=1 SV=1
3	Q0KIE7	2.86e-30	125	1549	0.234	0.059	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
4	Q24241	3.11e-30	125	1549	0.234	0.059	Q24241_DROME Ankyrin OS=Drosophila melanogaster OX=7227 GN=Ank PE=4 SV=1
5	Q9NCP8	8.64e-29	120	1159	0.244	0.082	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
6	M9PHP8	9.86e-29	120	1309	0.244	0.073	M9PHP8_DROME Ankyrin 2, isoform W OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	A8JNM7	1.00e-28	120	4114	0.247	0.023	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
8	M9MRS5	1.01e-28	120	4496	0.247	0.021	M9MRS5_DROME Ankyrin 2, isoform R OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
9	X2JC49	1.01e-28	120	4233	0.247	0.023	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
10	M9PEN3	1.05e-28	120	4373	0.247	0.022	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	A8JNM5	1.06e-28	120	4264	0.247	0.023	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
12	M9MRR4	1.06e-28	120	4223	0.247	0.023	M9MRR4_DROME Ankyrin 2, isoform T OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
13	M9MSK6	1.06e-28	120	4352	0.247	0.022	M9MSK6_DROME Ankyrin 2, isoform Q OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
14	Q7KU92	1.10e-28	120	4083	0.247	0.024	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
15	M9MS19	1.12e-28	120	4230	0.247	0.023	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	M9MRX1	1.13e-28	120	4329	0.247	0.022	M9MRX1_DROME Ankyrin 2, isoform S OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	A8JNM6	1.18e-28	120	4189	0.247	0.023	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	Q8SWY2	1.22e-28	120	1009	0.244	0.094	Q8SWY2_DROME GH01626p OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=2 SV=1
19	Q7KU95	1.23e-28	120	2404	0.247	0.040	Q7KU95_DROME Ankyrin 2, isoform M OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	A8JNM4	1.26e-28	120	2532	0.247	0.038	A8JNM4_DROME Ankyrin 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.7e-21	86.9	Ankyrin repeat
2	PF12796 Ank_2	4.5e-38	141.0	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	3e-19	77.9	Ankyrin repeat
4	PF13637 Ank_4	2.1e-40	147.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.3e-21	86.3	Ankyrin repeats (many copies)
6	PF08898 DUF1843	1.8e+02	14.0	Domain of unknown function (DUF1843)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377051

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000157812	0.900	26S proteasome regulatory subunit 6B
2	9606.ENSP00000310572	0.881	26S proteasome regulatory subunit 8
3	9606.ENSP00000357879	0.859	26S proteasome non-ATPase regulatory subunit 4
4	9606.ENSP00000391211	0.841	26S proteasome regulatory subunit 7
5	9606.ENSP00000481029	0.832	26S proteasome regulatory subunit 6A
6	9606.ENSP00000309474	0.824	26S proteasome non-ATPase regulatory subunit 1
7	9606.ENSP00000310129	0.772	26S proteasome non-ATPase regulatory subunit 2
8	9606.ENSP00000434724	0.763	Coiled-coil domain-containing protein 90B, mitochondrial
9	9606.ENSP00000219313	0.750	26S proteasome non-ATPase regulatory subunit 7
10	9606.ENSP00000358149	0.737	BolA-like protein 1
11	9606.ENSP00000298281	0.711	Pre-mRNA cleavage complex 2 protein Pcf11
12	9606.ENSP00000455507	0.705	Obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
13	9606.ENSP00000440485	0.690	26S proteasome non-ATPase regulatory subunit 9
14	9606.ENSP00000348442	0.653	26S proteasome non-ATPase regulatory subunit 12
15	9606.ENSP00000401802	0.653	26S proteasome regulatory subunit 10B
16	9606.ENSP00000264639	0.628	26S proteasome non-ATPase regulatory subunit 3
17	9606.ENSP00000392147	0.625	Protein phosphatase 6 catalytic subunit
18	9606.ENSP00000266066	0.616	Secreted frizzled-related protein 5
19	9606.ENSP00000261712	0.611	26S proteasome non-ATPase regulatory subunit 11
20	9606.ENSP00000274063	0.609	Secreted frizzled-related protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.977	regulation of cellular process
GO:0019222	0.887	regulation of metabolic process
GO:0060255	0.847	regulation of macromolecule metabolic process
GO:0031323	0.742	regulation of cellular metabolic process
GO:0009987	0.655	cellular process
GO:0080090	0.619	regulation of primary metabolic process
GO:0051171	0.619	regulation of nitrogen compound metabolic process
GO:0019219	0.523	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.489	positive regulation of biological process
GO:0010468	0.485	regulation of gene expression
GO:0008152	0.358	metabolic process
GO:0071704	0.339	organic substance metabolic process
GO:0051252	0.337	regulation of RNA metabolic process
GO:0048522	0.315	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0070013	0.988	intracellular organelle lumen
GO:0005654	0.978	nucleoplasm
GO:0005737	0.956	cytoplasm
GO:0005829	0.922	cytosol
GO:0032991	0.307	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]