StarFunc result for job id Q8N9B5

User Input

>input (988 residues)
MSFALEETLESDWVAVRPHVFDEREKHKFVFIVAWNEIEGKFAITCHNRTAQRQRSGSRE
QAGARGGAEAGGAASDGSRGPGSPAGRGRPEATASATLVRSPGPRRSSAWAEGGSPRSTR
SLLGDPRLRSPGSKGAESRLRSPVRAKPIPGQKTSEADDAAGAAAAAARPAPREAQVSSV
RIVSASGTVSEEIEVLEMVKEDEAPLALSDAEQPPPATELESPAEECSWAGLFSFQDLRA
VHQQLCSVNSQLEPCLPVFPEEPSGMWTVLFGGAPEMTEQEIDTLCYQLQVYLGHGLDTC
GWKILSQVLFTETDDPEEYYESLSELRQKGYEEVLQRARKRIQELLDKHKNTESMVELLD
LYQMEDEAYSSLAEATTELYQYLLQPFRDMRELAMLRRQQIKISMENDYLGPRRIESLQK
EDADWQRKAHMAVLSIQDLTVKYFEITAKAQKAVYDRMRADQKKFGKASWAAAAERMEKL
QYAVSKETLQMMRAKEICLEQRKHALKEEMQSLRGGTEAIARLDQLEADYYDLQLQLYEV
QFEILKCEELLLTAQLESIKRLISEKRDEVVYYDTYESMEAMLEKEEMAASAYLQREELQ
KLQQKARQLEARRGRVSAKKSYLRNKKEICIAKHNEKIQQRTRIEDEYRTHHTVQLKREK
LHDEEERKSAWVSQERQRTLDRLRTFKQRYPGQVILKSTRLRLAHARRKGAASPVLQEDH
CDSLPSVLQVEEKTEEVGEGRVKRGPSQTTEPQSLVQLEDTSLTQLEATSLPLSGVTSEL
PPTISLPLLNNNLEPCSVTINPLPSPLPPTPPPPPPPPPPPPPPPLPVAKDSGPETLEKD
LPRKEGNEKRIPKSASAPSAHLFDSSQLVSARKKLRKTAEGLQRRRVSSPMDEVLASLKR
GSFHLKKVEQRTLPPFPDEDDSNNILAQIRKGVKLKKVQKDVLRESFTLLPDTDPLTRSI
HEALRRIKEASPESEDEEEALPCTDWEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N9B5	1.000	1.000	0.000	988	1.000	1.000	Q8N9B5.pdb.gz	JMY_HUMAN Junction-mediating and -regulatory protein OS=Homo sapiens OX=9606 GN=JMY PE=1 SV=2
2	AFDB:Q9QXM1	0.582	0.585	2.468E-103	983	0.873	0.878	Q9QXM1.pdb.gz	JMY_MOUSE Junction-mediating and -regulatory protein OS=Mus musculus OX=10090 GN=Jmy PE=1 SV=1
3	AFDB:P40450	0.094	0.077	9.446E-5	1375	0.122	0.088	P40450.pdb.gz	BNR1_YEAST BNI1-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNR1 PE=1 SV=1
4	AFDB:Q5AAF4	0.090	0.065	5.120E-4	1485	0.113	0.075	Q5AAF4.pdb.gz	BNR1_CANAL Formin BNR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNR1 PE=1 SV=1
5	AFDB:Q9P6S3	0.092	0.087	2.637E-3	1052	0.111	0.105	Q9P6S3.pdb.gz	UDS1_SCHPO Up-regulated during septation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uds1 PE=1 SV=1
6	AFDB:Q5VT52	0.072	0.056	1.226E-2	1461	0.077	0.052	Q5VT52.pdb.gz	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
7	AFDB:Q9M0E5	0.070	0.052	1.358E-2	1494	0.102	0.068	Q9M0E5.pdb.gz	VPS15_ARATH Serine/threonine-protein kinase VPS15 OS=Arabidopsis thaliana OX=3702 GN=VPS15 PE=1 SV=1
8	PDB:7dkhI	0.069	0.073	2.765E-2	914	0.070	0.075	7dkhI.pdb.gz
9	AFDB:Q9VHW1	0.089	0.088	3.244E-2	1019	0.123	0.120	Q9VHW1.pdb.gz	Q9VHW1_DROME Muscarinic acetylcholine Receptor, B-type, isoform A OS=Drosophila melanogaster OX=7227 GN=mAChR-B PE=2 SV=2
10	PDB:6tedQ	0.062	0.068	3.760E-2	890	0.075	0.083	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
11	PDB:7ajlAAA	0.076	0.177	3.760E-2	290	0.033	0.114	7ajlAAA.pdb.gz
12	AFDB:Q96JE7	0.054	0.052	3.782E-2	1060	0.138	0.128	Q96JE7.pdb.gz	SC16B_HUMAN Protein transport protein Sec16B OS=Homo sapiens OX=9606 GN=SEC16B PE=1 SV=2
13	AFDB:G5ECM4	0.081	0.053	5.997E-2	1694	0.094	0.055	G5ECM4.pdb.gz	G5ECM4_CAEEL GTL-1 OS=Caenorhabditis elegans OX=6239 GN=gtl-1 PE=1 SV=1
14	PDB:7qe7N	0.080	0.104	9.453E-2	682	0.066	0.095	7qe7N.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
15	PDB:6gn0A	0.074	0.224	1.285E-1	239	0.024	0.100	6gn0A.pdb.gz
16	PDB:3axyC	0.075	0.233	1.748E-1	235	0.030	0.128	3axyC.pdb.gz	14-3-3 proteins act as intracellular receptors for rice Hd3a florigen
17	PDB:2x1gF	0.076	0.082	2.038E-1	896	0.041	0.046	2x1gF.pdb.gz
18	PDB:6bq1B	0.046	0.054	2.038E-1	728	0.036	0.049	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
19	PDB:7ktsA	0.056	0.031	2.145E-1	3042	0.059	0.019	7ktsA.pdb.gz
20	PDB:6ygbB	0.086	0.110	2.258E-1	725	0.024	0.033	6ygbB.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N9B5	0.0	2011	988	1.000	1.000	JMY_HUMAN Junction-mediating and -regulatory protein OS=Homo sapiens OX=9606 GN=JMY PE=1 SV=2
2	Q9QXM1	0.0	1598	983	0.863	0.868	JMY_MOUSE Junction-mediating and -regulatory protein OS=Mus musculus OX=10090 GN=Jmy PE=1 SV=1
3	Q571B6	1.68e-102	340	793	0.196	0.245	WHAMM_MOUSE WASP homolog-associated protein with actin, membranes and microtubules OS=Mus musculus OX=10090 GN=Whamm PE=1 SV=2
4	Q8TF30	1.67e-99	333	809	0.202	0.247	WHAMM_HUMAN WASP homolog-associated protein with actin, membranes and microtubules OS=Homo sapiens OX=9606 GN=WHAMM PE=1 SV=2
5	Q9Z0H8	1.3	35.4	1047	0.059	0.055	CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus OX=10090 GN=Clip2 PE=1 SV=2
6	O55156	3.8	33.9	1046	0.030	0.029	CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus OX=10116 GN=Clip2 PE=1 SV=1
7	Q9UDT6	3.9	33.9	1046	0.056	0.053	CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2 PE=1 SV=1
8	Q20748	6.3	33.1	595	0.028	0.047	ATAD3_CAEEL ATPase family AAA domain-containing protein 3 OS=Caenorhabditis elegans OX=6239 GN=atad-3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15871 JMY	1e-156	533.4	Junction-mediating and -regulatory protein
2	PF02205 WH2	8.3	17.6	WH2 motif
3	PF15920 WHAMM-JMY_N	3e-23	92.8	N-terminal of Junction-mediating and WASP homolog-associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379441

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
2	9606.ENSP00000269305	0.988	Cellular tumor antigen p53
3	9606.ENSP00000258821	0.963	Tetratricopeptide repeat protein 5
4	9606.ENSP00000258149	0.961	E3 ubiquitin-protein ligase Mdm2
5	9606.ENSP00000262367	0.943	CREB-binding protein
6	9606.ENSP00000356150	0.922	Protein Mdm4
7	9606.ENSP00000272317	0.903	Ubiquitin-40S ribosomal protein S27a
8	9606.ENSP00000441543	0.901	Polyubiquitin-C
9	9606.ENSP00000304697	0.900	Polyubiquitin-B
10	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
11	9606.ENSP00000365891	0.706	Wiskott-Aldrich syndrome protein
12	9606.ENSP00000319169	0.701	Protein arginine N-methyltransferase 5
13	9606.ENSP00000378912	0.695	Protein cordon-bleu
14	9606.ENSP00000376368	0.662	Wiskott-Aldrich syndrome protein family member 1
15	9606.ENSP00000351664	0.660	[F-actin]-monooxygenase MICAL1
16	9606.ENSP00000277010	0.650	Sigma non-opioid intracellular receptor 1
17	9606.ENSP00000483313	0.637	Wiskott-Aldrich syndrome protein family member 2
18	9606.ENSP00000345656	0.628	Vesicle-associated membrane protein-associated protein A
19	9606.ENSP00000297532	0.614	Fas-activated serine/threonine kinase
20	9606.ENSP00000318884	0.614	Formin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	0.999	microtubule binding
GO:0003713	0.571	transcription coactivator activity
GO:0044877	0.545	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.979	response to stimulus
GO:0007154	0.967	cell communication
GO:0051716	0.966	cellular response to stimulus
GO:0006950	0.944	response to stress
GO:0050794	0.925	regulation of cellular process
GO:0071840	0.896	cellular component organization or biogenesis
GO:0033554	0.896	cellular response to stress
GO:0016043	0.878	cellular component organization
GO:0071496	0.847	cellular response to external stimulus
GO:0009991	0.842	response to extracellular stimulus
GO:0048518	0.837	positive regulation of biological process
GO:0048522	0.817	positive regulation of cellular process
GO:0009267	0.678	cellular response to starvation
GO:0023052	0.548	signaling
GO:0007165	0.532	signal transduction
GO:0019222	0.515	regulation of metabolic process
GO:0097435	0.496	supramolecular fiber organization
GO:0060255	0.488	regulation of macromolecule metabolic process
GO:0007015	0.485	actin filament organization
GO:0051171	0.479	regulation of nitrogen compound metabolic process
GO:0080090	0.477	regulation of primary metabolic process
GO:0019219	0.460	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.432	regulation of gene expression
GO:0051252	0.432	regulation of RNA metabolic process
GO:0010556	0.322	regulation of macromolecule biosynthetic process
GO:0031326	0.322	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.996	membrane-enclosed lumen
GO:0016020	0.986	membrane
GO:0005654	0.986	nucleoplasm
GO:0005737	0.978	cytoplasm
GO:0005829	0.956	cytosol
GO:0031090	0.921	organelle membrane
GO:0031982	0.910	vesicle
GO:0098588	0.891	bounding membrane of organelle
GO:0031410	0.868	cytoplasmic vesicle
GO:0031252	0.726	cell leading edge
GO:0043232	0.632	intracellular non-membrane-bounded organelle
GO:0005773	0.549	vacuole
GO:0012505	0.489	endomembrane system
GO:0005774	0.376	vacuolar membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]