StarFunc result for job id Q8N9C0

User Input

>input (903 residues)
MTTIHSRQMLQEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNI
PAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSIN
KEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKK
KQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPL
EDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNV
NMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVW
KFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTVDRIPIK
FVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDA
QLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDE
KVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIAD
PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE
DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLEPPGFASQPQVTDVTKEAVTIT
WNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNK
AGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRA
EDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPGL
TTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86VF2	0.197	0.145	8.790E-71	1251	0.318	0.229	Q86VF2.pdb.gz	IGFN1_HUMAN Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IGFN1 PE=1 SV=2
2	AFDB:A0A1L1QZU5	0.263	0.191	4.523E-69	1287	0.262	0.184	A0A1L1QZU5.pdb.gz	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
3	AFDB:Q90688	0.271	0.199	9.497E-69	1272	0.241	0.171	Q90688.pdb.gz	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
4	AFDB:P56741	0.263	0.193	2.188E-68	1274	0.248	0.176	P56741.pdb.gz	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2
5	AFDB:E7EZ79	0.241	0.177	1.582E-65	1266	0.249	0.178	E7EZ79.pdb.gz
6	AFDB:A6QP89	0.274	0.212	1.657E-65	1198	0.248	0.187	A6QP89.pdb.gz	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
7	AFDB:Q14896	0.262	0.192	2.759E-65	1274	0.248	0.176	Q14896.pdb.gz	MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens OX=9606 GN=MYBPC3 PE=1 SV=4
8	AFDB:P16419	0.255	0.210	4.188E-65	1132	0.235	0.187	P16419.pdb.gz	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
9	AFDB:Q5U3B1	0.271	0.215	8.394E-65	1168	0.248	0.192	Q5U3B1.pdb.gz	Q5U3B1_DANRE Myosin-binding protein C, slow-type OS=Danio rerio OX=7955 GN=zgc:92073 PE=1 SV=1
10	AFDB:A0A571BEN1	0.226	0.184	1.846E-64	1139	0.249	0.198	A0A571BEN1.pdb.gz	A0A571BEN1_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
11	PDB:5oj2B	0.157	0.194	4.838E-30	692	0.150	0.195	5oj2B.pdb.gz
12	PDB:1e07A	0.211	0.269	3.608E-25	642	0.105	0.148	1e07A.pdb.gz
13	PDB:7sqcO0	0.138	0.118	6.294E-22	1140	0.101	0.080	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:7q1yA	0.134	0.097	3.609E-16	1374	0.091	0.060	7q1yA.pdb.gz
15	PDB:7q5zA	0.139	0.101	1.829E-15	1344	0.096	0.065	7q5zA.pdb.gz
16	PDB:5a42A	0.101	0.064	4.917E-14	1597	0.135	0.076	5a42A.pdb.gz
17	PDB:6dldD	0.114	0.293	7.125E-14	269	0.059	0.197	6dldD.pdb.gz
18	PDB:2rcjC	0.134	0.189	2.863E-13	523	0.072	0.124	2rcjC.pdb.gz
19	PDB:7vonA	0.123	0.089	5.231E-13	1399	0.093	0.060	7vonA.pdb.gz
20	PDB:4aq1A	0.133	0.160	7.940E-13	721	0.097	0.122	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86VF2	7.54e-107	360	1251	0.303	0.219	IGFN1_HUMAN Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IGFN1 PE=1 SV=2
2	Q8WZ42	1.51e-77	280	34350	0.239	0.006	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
3	A0A8I5ZUN3	1.90e-77	279	35375	0.212	0.005	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
4	A0A8I5ZU83	1.94e-77	279	26931	0.212	0.007	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
5	A2ASS6	2.53e-77	279	35213	0.210	0.005	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
6	A0A571BEN1	9.98e-70	253	1139	0.188	0.149	A0A571BEN1_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
7	Q6P6L5	1.05e-69	253	1124	0.188	0.151	Q6P6L5_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
8	D3YU50	1.44e-69	253	1127	0.188	0.151	D3YU50_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
9	Q00872	5.82e-67	245	1141	0.188	0.149	MYPC1_HUMAN Myosin-binding protein C, slow-type OS=Homo sapiens OX=9606 GN=MYBPC1 PE=1 SV=2
10	A6QP89	3.59e-65	240	1198	0.181	0.136	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
11	H2FLH2	2.69e-64	239	6927	0.267	0.035	H2FLH2_CAEEL Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=1
12	Q23551	4.10e-64	239	7158	0.267	0.034	UNC22_CAEEL Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=3
13	H2FLH3	1.44e-63	237	6848	0.269	0.035	H2FLH3_CAEEL Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=1
14	Q86T42	1.86e-61	225	783	0.162	0.186	Q86T42_HUMAN Uncharacterized protein DKFZp451E186 OS=Homo sapiens OX=9606 GN=DKFZp451E186 PE=2 SV=1
15	A0A1L1QZU5	2.26e-60	226	1287	0.194	0.136	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
16	P16419	4.77e-60	224	1132	0.181	0.144	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
17	Q5U3B1	1.96e-59	223	1168	0.181	0.140	Q5U3B1_DANRE Myosin-binding protein C, slow-type OS=Danio rerio OX=7955 GN=zgc:92073 PE=1 SV=1
18	Q14896	1.48e-57	218	1274	0.187	0.133	MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens OX=9606 GN=MYBPC3 PE=1 SV=4
19	D1YSG0	1.54e-57	218	8933	0.258	0.026	D1YSG0_DROME Bent, isoform F OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
20	X2JD89	1.79e-57	218	8602	0.258	0.027	X2JD89_DROME Bent, isoform J OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	4.3e+02	12.7	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	0.00047	31.5	CD80-like C2-set immunoglobulin domain
3	PF10670 DUF4198	4.1e+02	12.6	Domain of unknown function (DUF4198)
4	PF00041 fn3	1.6e-29	113.4	Fibronectin type III domain
5	PF20418 Herpes_gE_N	7.2	17.9	Alphaherpesvirus glycoprotein E N-terminal
6	PF07679 I-set	1.3e-74	257.6	Immunoglobulin I-set domain
7	PF00047 ig	1.3e-27	107.1	Immunoglobulin domain
8	PF13895 Ig_2	2.1e-15	68.1	Immunoglobulin domain
9	PF13927 Ig_3	4.1e-43	157.1	Immunoglobulin domain
10	PF16706 Izumo-Ig	36	15.7	Izumo-like Immunoglobulin domain
11	PF10179 NDNF	35	15.9	Neuron-derived neurotrophic factor, first Fn(III) domain
12	PF16656 Pur_ac_phosph_N	1.9	20.5	Purple acid Phosphatase, N-terminal domain
13	PF11465 Receptor_2B4	0.66	21.6	Natural killer cell receptor 2B4
14	PF20623 Sgo0707_N2	9	17.2	Sgo0707 N2 domain
15	PF18362 THB	3.1e-15	66.7	Tri-helix bundle domain
16	PF07686 V-set	5.6e-13	60.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000007058

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000006559	0.628	Calmodulin-like 5
2	9593.ENSGGOP00000006954	0.567	Titin-cap
3	9593.ENSGGOP00000028342	0.539	MSS51 mitochondrial translational activator
4	9593.ENSGGOP00000016225	0.525	Coiled-coil domain containing 8
5	9593.ENSGGOP00000025093	0.516	Myosin, heavy chain 10, non-muscle
6	9593.ENSGGOP00000028733	0.504	Uncharacterized protein
7	9593.ENSGGOP00000010283	0.503	Cullin 7
8	9593.ENSGGOP00000018250	0.501	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.906	structural molecule activity
GO:0008092	0.781	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.915	regulation of biological process
GO:0032501	0.840	multicellular organismal process
GO:0009987	0.839	cellular process
GO:0050794	0.822	regulation of cellular process
GO:0003012	0.777	muscle system process
GO:0006936	0.370	muscle contraction
GO:0032502	0.369	developmental process
GO:0071840	0.353	cellular component organization or biogenesis
GO:0048856	0.353	anatomical structure development
GO:0016043	0.318	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0099081	0.872	supramolecular polymer
GO:0099512	0.855	supramolecular fiber
GO:0043292	0.649	contractile fiber
GO:0030016	0.613	myofibril
GO:0030017	0.564	sarcomere
GO:0043227	0.547	membrane-bounded organelle
GO:0005856	0.341	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]