StarFunc result for job id Q8N9N8

User Input

>input (165 residues)
MSQATKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKN
IWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQT
QPELPAEPQLSGEESSSEDDSDLFVNTNRRQYHESEEESEEEEAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R5B9	0.855	0.855	7.767E-30	165	1.000	1.000	A0A024R5B9.pdb.gz
2	PDB:6zxgj	0.625	0.881	3.281E-21	116	0.703	1.000	6zxgj.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
3	AFDB:Q23646	0.663	0.626	5.912E-16	175	0.358	0.337	Q23646.pdb.gz	EIF1A_CAEEL Probable RNA-binding protein EIF1AD OS=Caenorhabditis elegans OX=6239 GN=ZK856.11 PE=3 SV=1
4	AFDB:Q9Y803	0.505	0.638	2.905E-10	127	0.200	0.260	Q9Y803.pdb.gz	YN98_SCHPO S1-like domain-containing protein C146.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC146.08c PE=1 SV=1
5	AFDB:Q57YI9	0.515	0.496	1.112E-9	172	0.170	0.163	Q57YI9.pdb.gz	Q57YI9_TRYB2 Eukaryotic translation initiation factor 1A, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.1060 PE=3 SV=1
6	AFDB:Q9SJB9	0.502	0.565	1.531E-9	145	0.218	0.248	Q9SJB9.pdb.gz	Q9SJB9_ARATH Eukaryotic translation initiation factor 4C OS=Arabidopsis thaliana OX=3702 GN=At2g04520 PE=1 SV=1
7	AFDB:Q9NJB4	0.485	0.538	5.498E-9	148	0.170	0.189	Q9NJB4.pdb.gz	Q9NJB4_DROME Eukaryotic translation initiation factor 4C OS=Drosophila melanogaster OX=7227 GN=eIF1A PE=2 SV=1
8	AFDB:A0A2R8QK22	0.531	0.446	5.861E-9	200	0.212	0.175	A0A2R8QK22.pdb.gz
9	AFDB:I7MK25	0.520	0.450	8.068E-9	193	0.194	0.166	I7MK25.pdb.gz	I7MK25_TETTS Eukaryotic translation initiation factor 4C OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00497990 PE=1 SV=1
10	AFDB:P38912	0.499	0.535	1.042E-8	153	0.158	0.170	P38912.pdb.gz	IF1A_YEAST Eukaryotic translation initiation factor 1A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF11 PE=1 SV=1
11	AFDB:P55877	0.521	0.614	1.345E-8	138	0.152	0.181	P55877.pdb.gz	IF1A_SCHPO Eukaryotic translation initiation factor 1A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif11 PE=2 SV=2
12	PDB:4btsA0	0.473	0.761	1.405E-7	99	0.121	0.202	4btsA0.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
13	PDB:6fyxi	0.514	0.680	8.967E-7	121	0.133	0.182	6fyxi.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
14	PDB:1d7qA	0.460	0.523	1.158E-6	143	0.152	0.175	1d7qA.pdb.gz	The eIF1A solution structure reveals a large RNA-binding surface important for scanning function.
15	PDB:3i4oA	0.364	0.821	9.547E-6	68	0.079	0.191	3i4oA.pdb.gz
16	PDB:1zo1W	0.338	0.735	2.488E-4	71	0.085	0.197	1zo1W.pdb.gz
17	PDB:6msjB	0.323	0.143	4.714E-4	411	0.097	0.039	6msjB.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
18	PDB:5uz4Z	0.353	0.194	5.357E-4	323	0.115	0.059	5uz4Z.pdb.gz	The cryo-EM structure of YjeQ bound to the 30S subunit suggests a fidelity checkpoint function for this protein in ribosome assembly.
19	PDB:4dapA	0.360	0.264	5.711E-4	232	0.091	0.065	4dapA.pdb.gz
20	PDB:6d6qG	0.274	0.198	7.375E-4	237	0.067	0.046	6d6qG.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N9N8	1.04e-120	338	165	1.000	1.000	EIF1A_HUMAN Probable RNA-binding protein EIF1AD OS=Homo sapiens OX=9606 GN=EIF1AD PE=1 SV=1
2	E9PS76	1.28e-81	238	114	0.691	1.000	E9PS76_HUMAN Probable RNA-binding protein EIF1AD (Fragment) OS=Homo sapiens OX=9606 GN=EIF1AD PE=1 SV=1
3	E9PLI6	9.53e-81	236	113	0.685	1.000	E9PLI6_HUMAN Probable RNA-binding protein EIF1AD (Fragment) OS=Homo sapiens OX=9606 GN=EIF1AD PE=1 SV=1
4	E9PS30	1.32e-52	163	78	0.473	1.000	E9PS30_HUMAN Probable RNA-binding protein EIF1AD (Fragment) OS=Homo sapiens OX=9606 GN=EIF1AD PE=1 SV=1
5	Q23646	1.18e-27	103	175	0.297	0.280	EIF1A_CAEEL Probable RNA-binding protein EIF1AD OS=Caenorhabditis elegans OX=6239 GN=ZK856.11 PE=3 SV=1
6	Q9Y803	4.19e-11	59.3	127	0.182	0.236	YN98_SCHPO S1-like domain-containing protein C146.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC146.08c PE=1 SV=1
7	Q9VEA1	1.78e-07	50.1	148	0.218	0.243	Q9VEA1_DROME Eukaryotic translation initiation factor 4C OS=Drosophila melanogaster OX=7227 GN=eIF1A PE=1 SV=1
8	Q9NJB4	1.12e-06	47.8	148	0.212	0.236	Q9NJB4_DROME Eukaryotic translation initiation factor 4C OS=Drosophila melanogaster OX=7227 GN=eIF1A PE=2 SV=1
9	Q5XJR0	1.27e-05	45.1	144	0.158	0.181	Q5XJR0_DANRE Eukaryotic translation initiation factor 4C OS=Danio rerio OX=7955 GN=eif1ax PE=1 SV=1
10	Q9SJB9	1.87e-05	44.7	145	0.164	0.186	Q9SJB9_ARATH Eukaryotic translation initiation factor 4C OS=Arabidopsis thaliana OX=3702 GN=At2g04520 PE=1 SV=1
11	F4K1D3	2.35e-05	44.3	150	0.164	0.180	F4K1D3_ARATH Eukaryotic translation initiation factor 4C OS=Arabidopsis thaliana OX=3702 GN=MXH1.2 PE=1 SV=1
12	Q6VV72	6.88e-05	42.7	144	0.152	0.174	IF1A_RAT Eukaryotic translation initiation factor 1A OS=Rattus norvegicus OX=10116 GN=Eif1a PE=2 SV=3
13	P47813	1.75e-04	42.0	144	0.152	0.174	IF1AX_HUMAN Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2
14	Q8BMJ3	1.75e-04	42.0	144	0.152	0.174	IF1AX_MOUSE Eukaryotic translation initiation factor 1A, X-chromosomal OS=Mus musculus OX=10090 GN=Eif1ax PE=2 SV=3
15	O14602	2.20e-04	41.6	144	0.152	0.174	IF1AY_HUMAN Eukaryotic translation initiation factor 1A, Y-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AY PE=1 SV=4
16	Q4V9N9	2.50e-04	41.2	144	0.145	0.167	Q4V9N9_DANRE Eukaryotic translation initiation factor 4C OS=Danio rerio OX=7955 GN=wu:fb38c07 PE=1 SV=1
17	P55877	8.65e-04	39.7	138	0.133	0.159	IF1A_SCHPO Eukaryotic translation initiation factor 1A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif11 PE=2 SV=2
18	P38912	0.009	37.0	153	0.121	0.131	IF1A_YEAST Eukaryotic translation initiation factor 1A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF11 PE=1 SV=1
19	I7MK25	0.14	33.9	193	0.164	0.140	I7MK25_TETTS Eukaryotic translation initiation factor 4C OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00497990 PE=1 SV=1
20	Q57YI9	0.27	33.1	172	0.133	0.128	Q57YI9_TRYB2 Eukaryotic translation initiation factor 1A, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.1060 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01176 eIF-1a	5.4e-15	66.3	Translation initiation factor 1A / IF-1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010364740.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010362242.1	0.824	Belongs to the eukaryotic ribosomal protein eS30 family.
2	61622.XP_010384342.1	0.824	Belongs to the universal ribosomal protein uS12 family.
3	61622.XP_010378976.1	0.795	Belongs to the universal ribosomal protein uS4 family.
4	61622.XP_010363500.1	0.767	Belongs to the eukaryotic ribosomal protein eS21 family.
5	61622.XP_010356154.1	0.752	Prefoldin subunit 6
6	61622.XP_010362038.1	0.740	Neural precursor cell expressed, developmentally down-regulated 8
7	61622.XP_010374460.1	0.740	NEDD8
8	61622.XP_010360841.1	0.733	40S ribosomal protein S20
9	61622.XP_010368731.1	0.733	Belongs to the universal ribosomal protein uS8 family.
10	61622.XP_010376465.1	0.730	ubiquitin-40S ribosomal protein S27a
11	61622.XP_010385257.1	0.730	Belongs to the universal ribosomal protein uS7 family.
12	61622.XP_010364012.1	0.728	Belongs to the eukaryotic ribosomal protein eS6 family.
13	61622.XP_010370819.1	0.727	May play a role during erythropoiesis through regulation of transcription factor DDIT3
14	61622.XP_010353727.1	0.726	May play a role in mRNA degradation.
15	61622.XP_010373201.1	0.725	Belongs to the universal ribosomal protein uS19 family.
16	61622.XP_010378210.1	0.725	Ribosomal protein S28
17	61622.XP_010387805.1	0.721	Ribosomal protein S29
18	61622.XP_010351555.1	0.719	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 138 ESTs, 36 Proteins, and 37% coverage of the annotated genomic feature by RNAseq alignments
19	61622.XP_010356159.1	0.719	Belongs to the universal ribosomal protein uS13 family.
20	61622.XP_010356212.1	0.719	Belongs to the eukaryotic ribosomal protein eS7 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.624	nucleic acid binding
GO:0003723	0.540	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.986	biological regulation
GO:0050789	0.977	regulation of biological process
GO:0050794	0.966	regulation of cellular process
GO:0071704	0.873	organic substance metabolic process
GO:0006807	0.850	nitrogen compound metabolic process
GO:0044237	0.815	cellular metabolic process
GO:0019222	0.788	regulation of metabolic process
GO:0043170	0.779	macromolecule metabolic process
GO:0044238	0.728	primary metabolic process
GO:0034641	0.685	cellular nitrogen compound metabolic process
GO:0060255	0.671	regulation of macromolecule metabolic process
GO:0080090	0.579	regulation of primary metabolic process
GO:0044260	0.576	cellular macromolecule metabolic process
GO:0010467	0.553	gene expression
GO:1901576	0.552	organic substance biosynthetic process
GO:0051171	0.545	regulation of nitrogen compound metabolic process
GO:0031323	0.536	regulation of cellular metabolic process
GO:0006412	0.530	translation
GO:0010468	0.520	regulation of gene expression
GO:0010556	0.447	regulation of macromolecule biosynthetic process
GO:0031326	0.447	regulation of cellular biosynthetic process
GO:0048518	0.438	positive regulation of biological process
GO:0019219	0.349	regulation of nucleobase-containing compound metabolic process
GO:0002181	0.341	cytoplasmic translation
GO:0032502	0.339	developmental process
GO:0051252	0.326	regulation of RNA metabolic process
GO:0032501	0.314	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016020	0.605	membrane
GO:0043232	0.427	intracellular non-membrane-bounded organelle
GO:0032991	0.357	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]