StarFunc result for job id Q8N9V6

User Input

>input (530 residues)
MASAGSTARRAGSGSWHSERGEGRGARPQPTPSGSMQQANKVSLKATWTDAESKQPSQPL
PDLADHLSAQATALARPRRPASLTPPRADPSPSKESDQTAIDQTAIGSYYQLFAAAVGNV
EWLRFCLNQSLREIPTDDKGFTAIHFAAQWGKLACLQVLVEEYKFPVDLLTNNSQTPLHL
VIHRDNTTVALPCIYYLLEKGADLNAQTCNGSTPLHLAARDGLLDCVKVLVQSGANVHAQ
DAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREMTKMKMFKSQLTLMEHNYLIEY
QKEHKILREAAIRKWLHGKLHPGHSLVSNTKQARATALSKTPEQRESQRSRSFHPSVDAR
LQCIPQPTEMPKPIYRKPTVKRPTMWNVSNNPARPPTTQISHSQGIRLGVHPDPTPEHDF
SSFLEVRPDGHGGARLHTVDGHWVAPVPRLPFEVLLRMLYPRVWPYRMKVPQGFYPISMR
EVPRKRHLGDNTFWTDTLAMNLRDTFDEAFLAAVRSHQGLPTLPSPQTNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N9V6	1.000	1.000	6.932E-81	530	1.000	1.000	Q8N9V6.pdb.gz	ANR53_HUMAN Ankyrin repeat domain-containing protein 53 OS=Homo sapiens OX=9606 GN=ANKRD53 PE=1 SV=3
2	AFDB:Q06547	0.289	0.385	3.459E-13	395	0.140	0.187	Q06547.pdb.gz	GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens OX=9606 GN=GABPB1 PE=1 SV=2
3	AFDB:Q8TAK5	0.296	0.348	9.980E-13	448	0.143	0.170	Q8TAK5.pdb.gz	GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens OX=9606 GN=GABPB2 PE=1 SV=1
4	AFDB:A0A024R7M1	0.291	0.573	2.209E-12	260	0.106	0.215	A0A024R7M1.pdb.gz
5	AFDB:Q9H9E1	0.291	0.482	2.209E-12	313	0.109	0.185	Q9H9E1.pdb.gz	ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens OX=9606 GN=ANKRA2 PE=1 SV=1
6	AFDB:Q9Z205	0.278	0.532	2.156E-11	269	0.096	0.190	Q9Z205.pdb.gz	RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus OX=10090 GN=Rfxank PE=1 SV=1
7	AFDB:Q9ET47	0.277	0.170	4.774E-11	871	0.153	0.093	Q9ET47.pdb.gz	ESPN_MOUSE Espin OS=Mus musculus OX=10090 GN=Espn PE=1 SV=2
8	AFDB:A0A024RE01	0.283	0.355	1.996E-10	420	0.166	0.210	A0A024RE01.pdb.gz
9	AFDB:A0JP26	0.149	0.137	2.602E-10	581	0.130	0.119	A0JP26.pdb.gz	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
10	AFDB:Q69ZU8	0.245	0.184	2.893E-10	712	0.147	0.110	Q69ZU8.pdb.gz	ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus OX=10090 GN=Ankrd6 PE=1 SV=2
11	PDB:6jd6B	0.280	0.747	4.271E-10	192	0.085	0.234	6jd6B.pdb.gz
12	PDB:8cs9A	0.285	0.191	4.504E-10	796	0.074	0.049	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:6mwqA	0.266	0.285	1.985E-9	493	0.102	0.110	6mwqA.pdb.gz
14	PDB:2dvwA	0.271	0.610	3.373E-9	229	0.075	0.175	2dvwA.pdb.gz
15	PDB:1bd8A	0.263	0.809	2.808E-8	156	0.066	0.224	1bd8A.pdb.gz
16	PDB:4oauC	0.270	0.209	5.030E-8	692	0.072	0.055	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
17	PDB:6v9hC	0.265	0.508	7.685E-8	270	0.072	0.141	6v9hC.pdb.gz
18	PDB:5vkqA	0.173	0.071	9.499E-8	1499	0.089	0.031	5vkqA.pdb.gz
19	PDB:1wg0A	0.251	0.516	1.891E-7	243	0.068	0.148	1wg0A.pdb.gz
20	PDB:6pqpA	0.244	0.212	3.972E-7	615	0.064	0.055	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N9V6	0.0	1106	530	1.000	1.000	ANR53_HUMAN Ankyrin repeat domain-containing protein 53 OS=Homo sapiens OX=9606 GN=ANKRD53 PE=1 SV=3
2	Q17490	3.21e-17	88.2	6994	0.092	0.007	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2
3	A8JNM5	2.80e-16	85.1	4264	0.102	0.013	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
4	X2JC49	2.89e-16	85.1	4233	0.102	0.013	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
5	M9PEN3	3.22e-16	85.1	4373	0.102	0.012	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
6	M9MRS5	3.49e-16	84.7	4496	0.102	0.012	M9MRS5_DROME Ankyrin 2, isoform R OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	A8JNM7	4.27e-16	84.3	4114	0.102	0.013	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
8	Q7KU92	4.34e-16	84.3	4083	0.102	0.013	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
9	A8JNM6	4.51e-16	84.3	4189	0.102	0.013	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
10	M9MRR4	4.67e-16	84.3	4223	0.102	0.013	M9MRR4_DROME Ankyrin 2, isoform T OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	M9MRX1	4.84e-16	84.3	4329	0.102	0.012	M9MRX1_DROME Ankyrin 2, isoform S OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
12	M9MS19	4.88e-16	84.3	4230	0.102	0.013	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
13	M9MSK6	4.89e-16	84.3	4352	0.102	0.012	M9MSK6_DROME Ankyrin 2, isoform Q OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
14	G5ECZ1	5.78e-16	84.0	1867	0.092	0.026	G5ECZ1_CAEEL AO66 ankyrin OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
15	Q8MQG0	6.86e-16	83.6	1841	0.092	0.027	Q8MQG0_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
16	Q7KU95	7.45e-16	83.6	2404	0.102	0.022	Q7KU95_DROME Ankyrin 2, isoform M OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	Q9NXR5	7.58e-16	82.0	420	0.085	0.107	ANR10_HUMAN Ankyrin repeat domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ANKRD10 PE=1 SV=2
18	A8JNM4	8.63e-16	83.6	2532	0.102	0.021	A8JNM4_DROME Ankyrin 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	X2JGD3	1.04e-15	83.2	2566	0.102	0.021	X2JGD3_DROME Ankyrin 2, isoform Y OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	M9PHP8	1.85e-15	82.4	1309	0.102	0.041	M9PHP8_DROME Ankyrin 2, isoform W OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.6e-14	64.8	Ankyrin repeat
2	PF12796 Ank_2	6.3e-22	89.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.4e-10	51.3	Ankyrin repeat
4	PF13637 Ank_4	1.8e-12	58.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.3e-12	58.9	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353796

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484945	0.561	PRAC2 small nuclear protein
2	9606.ENSP00000357465	0.556	Tudor domain-containing protein 10
3	9606.ENSP00000421258	0.542	Zinc finger protein 154
4	9606.ENSP00000262103	0.536	EF-hand calcium-binding domain-containing protein 1
5	9606.ENSP00000468531	0.530	Zinc finger protein 177
6	9606.ENSP00000415070	0.528	ZNF559-ZNF177 readthrough
7	9606.ENSP00000354633	0.517	Transcription initiation factor TFIID subunit 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.976	regulation of cellular process
GO:0009987	0.974	cellular process
GO:0071840	0.869	cellular component organization or biogenesis
GO:0051640	0.845	organelle localization
GO:0016043	0.836	cellular component organization
GO:0048522	0.836	positive regulation of cellular process
GO:0140014	0.815	mitotic nuclear division
GO:0070507	0.813	regulation of microtubule cytoskeleton organization
GO:0000070	0.810	mitotic sister chromatid segregation
GO:0007080	0.801	mitotic metaphase plate congression
GO:0090224	0.800	regulation of spindle organization
GO:0051130	0.747	positive regulation of cellular component organization
GO:0060236	0.738	regulation of mitotic spindle organization
GO:0031112	0.620	positive regulation of microtubule polymerization or depolymerization
GO:0032271	0.617	regulation of protein polymerization
GO:0031113	0.614	regulation of microtubule polymerization
GO:0051302	0.609	regulation of cell division
GO:0031334	0.608	positive regulation of protein-containing complex assembly
GO:1902905	0.605	positive regulation of supramolecular fiber organization
GO:0031116	0.593	positive regulation of microtubule polymerization
GO:1902412	0.592	regulation of mitotic cytokinesis
GO:0019222	0.384	regulation of metabolic process
GO:0080090	0.319	regulation of primary metabolic process
GO:0060255	0.313	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0043227	0.972	membrane-bounded organelle
GO:0043232	0.936	intracellular non-membrane-bounded organelle
GO:0005634	0.902	nucleus
GO:0000922	0.813	spindle pole
GO:0005737	0.407	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]