StarFunc result for job id Q8N9V7

User Input

>input (1692 residues)
MRRPPPLGPTTASGPEGNVRNLQKRQAPGPGAAGGCGPEAGGCRENKQKRRMVARATPGR
GEVESDKSVAASGAGKAARRQVEGRRGPVSPSDSSDPRGLEAAKEAELPLQTERHTKEKR
KVTEASSDDPQPGLDLVRKESLTSSESFQTVECLQSLGKESIIEGIKRRIRNKKLKSLEN
PPLKITENEATQNIKVEFQDELYKNTPKYSCNILSPEVENNSVLKLRDCNCFPHSKGCND
ENNLPYKPDGGCMHVAENFSKKENLRSLAEKSDTNSIPQLLQTEENVMGVNKLLPEESDL
YQSKTNGLLSCLQHEKNKYSIEESSVGRKPRKRMKLSEKADETVTEMNFSNEYNKSELML
QENQMIADGKEAETKSPLNVLRKVSHNTVSLMDHLLSVPETVEKETSSEHHVNAVFQKTI
EPLLKEETENASEPLGYESMASKEDFKSMKSFIGKSPNEYHIERRSSREDLRSASEELKL
SCQRTIPMTGKRTWPYYSCARISAWCWKKASLPESSYFLRGSQESCRQVDVPKHQTNQTH
LTDSKLLLQSSLTETNTESSSKEKLDSNSNCLSSVSAVEPTLMVIKEPIIKDDKKIKSEE
LSRRGSEVISNTTEDTQLTSETQSLTGNKKKARGNLTKLNLTATSKDGQEANNSAGKTIH
RKACIAQQTFIVPDLVKILNTGRLTNFKIPLLKNKSEKRKEVNAKSSEREAYSPLELLDN
LSGADVRQNRSKENVSMMMLGPQTLSIRNSVTPVQASSDSFYNKKSYSISPSFTKQGNNS
KPSNHVSEPGNIVSNKEVASLTVENNAFSCDPGYVEKSPSFCCNEQETFRPVSSEVRGRK
ITKNFSEVGFPDILKAYEDDVLLIDVIQDDPDLFGVSNEGELSFTSEVPKISQEPNVAGE
HQSTDSKYMETPVKKEPSDDLRELPVLDCGWIKPDICASNSAESEIKRDPKDVNTSLGEV
ANETSENETLGDFSEQIKGSDLDEKHRFTDKVITKEEKENIYEVCKSKDSRNADFMVGEC
QFAVPVPKPLCLLVPPLNLSGRQEDTILNTWMNDFRFLGKHSVLKLQNPETCEIFKREKN
VGVFQKSLGLMIPYKYCKFHFNTLRGCERPLCKFAHVPEQGDEKVCMDVFKKYININELC
LLQRAVNIFMEYYRKFPPGVYFDLQVLNDLLNSLLKHCLLKEVFQIVNLSIMVKMLPSLK
ILLNIFEYVATMKLRNAVPALIDIFCKLVEAGMVLDPEHFNYIVKLLYQVQASKQEITAV
LEMKSRLQMRRFKKNWKCDLDSALNKLEHCKEKGDWTKLGKLYINVKMGCEKFADFQTFC
ACIAETLTKNYEDERPDIPFCEFAETVSKDPQNSKVDKGVLGRIGISAMYFYHKLLQWSK
GRKVLEKLYELKIHFTSLKGLIGPEKLASRCQIVNVAAEIFLKSGSLDGAIWVMRESEWI
INTPLWPCDRLDVLNRHNLLCTIAHEILAKSLYRQTFEVLQNLPGFQNSQETVEVSQYSL
LFNKLLGSCIESSSLGMSSSVAEFMISKSIPIDFSFLRRLITSLGRSRLWLKARAHYKSA
LSLGCYPPLEGNLYRKLLLIPSYLSEIEMLLAIEIFMVSNASSIQSPGTSTQILQIVLKR
CEDNQSRSNDDYQAAVERLIMAARISDPKLFVKHMTVNVNKEQVYSLEHCSALKWLKENM
KWAGKVWLFSNH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5FYH1	0.385	0.393	0.000	1653	0.657	0.673	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
2	PDB:7dkhI	0.093	0.144	1.608E-5	914	0.054	0.101	7dkhI.pdb.gz
3	PDB:4m57A	0.099	0.189	1.676E-5	702	0.039	0.094	4m57A.pdb.gz
4	PDB:4bujB	0.099	0.114	1.441E-4	1367	0.038	0.048	4bujB.pdb.gz
5	AFDB:Q76E23	0.054	0.054	1.664E-4	1727	0.118	0.115	Q76E23.pdb.gz	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2
6	AFDB:E7F981	0.072	0.069	2.046E-4	1814	0.119	0.111	E7F981.pdb.gz	E7F981_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=3
7	PDB:7dhgC	0.067	0.153	2.179E-4	470	0.033	0.119	7dhgC.pdb.gz
8	AFDB:G0SAK3	0.069	0.067	2.516E-4	1793	0.126	0.119	G0SAK3.pdb.gz	NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP145 PE=1 SV=1
9	PDB:7po24	0.105	0.197	2.572E-4	592	0.037	0.106	7po24.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
10	PDB:7qe7Y	0.093	0.207	3.581E-4	502	0.041	0.137	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
11	PDB:6yj6A	0.105	0.172	3.890E-4	819	0.040	0.082	6yj6A.pdb.gz
12	PDB:2xwuB	0.086	0.138	4.986E-4	910	0.045	0.084	2xwuB.pdb.gz
13	AFDB:Q9VCH1	0.090	0.081	5.999E-4	2072	0.129	0.105	Q9VCH1.pdb.gz	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
14	AFDB:Q9W517	0.071	0.070	6.253E-4	1741	0.128	0.124	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
15	PDB:8a3tH	0.068	0.172	6.942E-4	505	0.035	0.117	8a3tH.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
16	PDB:4kvmB	0.099	0.177	7.541E-4	722	0.051	0.120	4kvmB.pdb.gz	Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
17	AFDB:A0A0R4IZ84	0.072	0.077	9.074E-4	1544	0.105	0.115	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
18	AFDB:P52948	0.075	0.072	9.457E-4	1817	0.120	0.112	P52948.pdb.gz	NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4
19	AFDB:G5EEH9	0.075	0.076	1.992E-3	1678	0.121	0.122	G5EEH9.pdb.gz	NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans OX=6239 GN=npp-10 PE=1 SV=1
20	AFDB:P48415	0.085	0.071	3.140E-3	2195	0.121	0.093	P48415.pdb.gz	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5FYH1	0.0	2129	1653	0.661	0.676	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
2	P49792	0.024	42.0	3224	0.026	0.014	RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2
3	O74441	0.50	37.4	574	0.012	0.037	CTL1_SCHPO Choline transporter-like protein ctl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctl1 PE=1 SV=1
4	Q9ERU9	1.6	36.2	3053	0.018	0.010	RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus OX=10090 GN=Ranbp2 PE=1 SV=2
5	Q94544	2.2	35.4	700	0.008	0.020	Q94544_DROME Phosphatidylinositol 4-phosphate 5-kinase OS=Drosophila melanogaster OX=7227 GN=sktl PE=2 SV=2
6	Q7JNK2	2.4	35.0	462	0.008	0.030	Q7JNK2_DROME Putative phosphatidyl-inositol-4-phosphate 5-kinase OS=Drosophila melanogaster OX=7227 GN=sktl PE=4 SV=1
7	Q15654	2.6	35.0	476	0.015	0.055	TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3
8	Q9W2R3	2.8	35.0	792	0.008	0.018	Q9W2R3_DROME LP03320p OS=Drosophila melanogaster OX=7227 GN=sktl PE=1 SV=2
9	O14986	9.0	33.5	540	0.007	0.022	PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens OX=9606 GN=PIP5K1B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14669 Asp_Glu_race_2	2.8e-84	292.7	Putative aspartate racemase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310303

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324204	0.650	Maturin
2	9606.ENSP00000379880	0.631	Leucine-rich repeat-containing protein 3B
3	9606.ENSP00000274643	0.629	Myosin light chain kinase family member 4
4	9606.ENSP00000359375	0.622	Fetal and adult testis-expressed transcript protein
5	9606.ENSP00000253693	0.606	Calpain-7
6	9606.ENSP00000312457	0.605	Brain and acute leukemia, cytoplasmic
7	9606.ENSP00000295628	0.602	Leucine-rich repeat-containing protein 58
8	9606.ENSP00000324920	0.584	Protein SIX6OS1
9	9606.ENSP00000332148	0.556	Zinc finger protein DZIP1L
10	9606.ENSP00000413537	0.556	AP20 region protein 1
11	9606.ENSP00000485610	0.556	Chromosome 3 open reading frame 35
12	9606.ENSP00000386452	0.523	Meiosis-specific coiled-coil domain-containing protein MEIOC
13	9606.ENSP00000373274	0.520	Zinc finger protein 860
14	9606.ENSP00000441930	0.513	Protein PIH1D3
15	9606.ENSP00000273179	0.505	CTD small phosphatase-like protein
16	9606.ENSP00000285046	0.505	FYVE, RhoGEF and PH domain-containing protein 5
17	9606.ENSP00000381429	0.504	CGG triplet repeat-binding protein 1
18	9606.ENSP00000340954	0.502	Cyclic nucleotide-binding domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.605	catalytic activity
GO:0016740	0.478	transferase activity
GO:0097159	0.349	organic cyclic compound binding
GO:1901363	0.302	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0071704	0.899	organic substance metabolic process
GO:0044238	0.896	primary metabolic process
GO:0044237	0.833	cellular metabolic process
GO:0006807	0.821	nitrogen compound metabolic process
GO:0043170	0.799	macromolecule metabolic process
GO:0050789	0.798	regulation of biological process
GO:0050794	0.714	regulation of cellular process
GO:0032502	0.710	developmental process
GO:0048856	0.687	anatomical structure development
GO:0016070	0.615	RNA metabolic process
GO:0032501	0.532	multicellular organismal process
GO:0009058	0.395	biosynthetic process
GO:0022414	0.375	reproductive process
GO:0019438	0.309	aromatic compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005654	0.972	nucleoplasm
GO:0005737	0.911	cytoplasm
GO:0016604	0.412	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.478	Transferases.

[back to server]