StarFunc result for job id Q8NA29

User Input

>input (543 residues)
MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTG
CALGFFLQIYLLDVAQKDEEVVFCFSSFQVGPFSASIILFVGRAWDAITDPLVGLCISKS
PWTCLGRLMPWIIFSTPLAVIAYFLIWFVPDFPHGQTYWYLLFYCLFETMVTCFHVPYSA
LTMFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSSTVASQSAN
HTHGTTSHRETQKAYLLAAGVIVCIYIICAVILILGVREQREPYEAQQSEPIAYFRGLRL
VMSHGPYIKLITGFLFTSLAFMLVEGNFVLFCTYTLGFRNEFQNLLLAIMLSATLTIPIW
QWFLTRFGKKTAVYVGISSAVPFLILVALMESNLIITYAVAVAAGISVAAAFLLPWSMLP
DVIDDFHLKQPHFHGTEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRGCSQPERVK
FTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELA
SIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NA29	1.000	1.000	2.670E-73	543	1.000	1.000	Q8NA29.pdb.gz	NLS1_HUMAN Sodium-dependent lysophosphatidylcholine symporter 1 OS=Homo sapiens OX=9606 GN=MFSD2A PE=1 SV=1
2	AFDB:Q9DA75	0.908	0.923	9.485E-59	534	0.829	0.843	Q9DA75.pdb.gz	NLS1_MOUSE Sodium-dependent lysophosphatidylcholine symporter 1 OS=Mus musculus OX=10090 GN=Mfsd2a PE=1 SV=1
3	AFDB:Q6DEJ6	0.878	0.910	1.053E-49	523	0.622	0.646	Q6DEJ6.pdb.gz	NLS1B_DANRE Sodium-dependent lysophosphatidylcholine symporter 1-B OS=Danio rerio OX=7955 GN=mfsd2ab PE=1 SV=1
4	PDB:7n98A	0.801	0.916	1.940E-44	473	0.707	0.812	7n98A.pdb.gz
5	PDB:7oixB	0.798	0.956	3.680E-44	451	0.786	0.947	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.
6	AFDB:Q5U3U7	0.751	0.765	7.265E-44	532	0.589	0.602	Q5U3U7.pdb.gz	NLS1A_DANRE Sodium-dependent lysophosphatidylcholine symporter 1-A OS=Danio rerio OX=7955 GN=mfsd2aa PE=2 SV=1
7	AFDB:Q3T9M1	0.805	0.883	5.264E-35	494	0.378	0.415	Q3T9M1.pdb.gz	MFS2B_MOUSE Sphingosine-1-phosphate transporter MFSD2B OS=Mus musculus OX=10090 GN=Mfsd2b PE=1 SV=1
8	AFDB:A6NFX1	0.816	0.877	4.083E-34	504	0.372	0.401	A6NFX1.pdb.gz	MFS2B_HUMAN Sphingosine-1-phosphate transporter MFSD2B OS=Homo sapiens OX=9606 GN=MFSD2B PE=1 SV=4
9	AFDB:P75683	0.761	0.892	5.661E-21	460	0.171	0.202	P75683.pdb.gz	YAGG_ECOLI Putative glycoside/cation symporter YagG OS=Escherichia coli (strain K12) OX=83333 GN=yagG PE=1 SV=1
10	AFDB:P31435	0.757	0.888	4.991E-20	460	0.162	0.191	P31435.pdb.gz	YICJ_ECOLI Inner membrane symporter YicJ OS=Escherichia coli (strain K12) OX=83333 GN=yicJ PE=1 SV=2
11	AFDB:P32136	0.770	0.889	4.401E-19	467	0.160	0.186	P32136.pdb.gz	YIHO_ECOLI Putative sulfoquinovose importer OS=Escherichia coli (strain K12) OX=83333 GN=yihO PE=3 SV=4
12	AFDB:P96792	0.746	0.839	5.933E-19	479	0.155	0.175	P96792.pdb.gz	XYLP_LACPE Isoprimeverose transporter OS=Lactiplantibacillus pentosus OX=1589 GN=xylP PE=1 SV=2
13	PDB:3o7qA	0.564	0.715	2.485E-8	414	0.107	0.140	3o7qA.pdb.gz
14	PDB:6wbvA	0.569	0.698	1.258E-7	429	0.099	0.126	6wbvA.pdb.gz	Structure of hepcidin-bound ferroportin reveals iron homeostatic mechanisms.
15	PDB:7sptA	0.558	0.633	1.847E-7	470	0.101	0.117	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
16	PDB:6oopA	0.528	0.696	4.724E-7	392	0.114	0.158	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
17	PDB:7bc7A	0.540	0.662	1.316E-6	432	0.101	0.127	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
18	PDB:4gbyA	0.567	0.636	1.774E-6	475	0.118	0.135	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
19	PDB:6thaA	0.517	0.609	2.496E-6	448	0.103	0.125	6thaA.pdb.gz
20	PDB:7wsmA	0.552	0.630	4.537E-6	464	0.114	0.134	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5U3U7	0.0	637	532	0.584	0.596	NLS1A_DANRE Sodium-dependent lysophosphatidylcholine symporter 1-A OS=Danio rerio OX=7955 GN=mfsd2aa PE=2 SV=1
2	Q6DEJ6	0.0	673	523	0.628	0.652	NLS1B_DANRE Sodium-dependent lysophosphatidylcholine symporter 1-B OS=Danio rerio OX=7955 GN=mfsd2ab PE=1 SV=1
3	Q8NA29	0.0	1116	543	1.000	1.000	NLS1_HUMAN Sodium-dependent lysophosphatidylcholine symporter 1 OS=Homo sapiens OX=9606 GN=MFSD2A PE=1 SV=1
4	Q9DA75	0.0	870	534	0.831	0.845	NLS1_MOUSE Sodium-dependent lysophosphatidylcholine symporter 1 OS=Mus musculus OX=10090 GN=Mfsd2a PE=1 SV=1
5	Q3T9M1	5.80e-126	379	494	0.379	0.417	MFS2B_MOUSE Sphingosine-1-phosphate transporter MFSD2B OS=Mus musculus OX=10090 GN=Mfsd2b PE=1 SV=1
6	A6NFX1	1.32e-124	376	504	0.379	0.409	MFS2B_HUMAN Sphingosine-1-phosphate transporter MFSD2B OS=Homo sapiens OX=9606 GN=MFSD2B PE=1 SV=4
7	P75683	2.43e-12	71.2	460	0.201	0.237	YAGG_ECOLI Putative glycoside/cation symporter YagG OS=Escherichia coli (strain K12) OX=83333 GN=yagG PE=1 SV=1
8	P96792	4.63e-07	54.7	479	0.186	0.211	XYLP_LACPE Isoprimeverose transporter OS=Lactiplantibacillus pentosus OX=1589 GN=xylP PE=1 SV=2
9	P0CE44	1.15e-06	53.5	457	0.171	0.204	UIDB_ECOLI Glucuronide carrier protein homolog OS=Escherichia coli (strain K12) OX=83333 GN=uidB PE=1 SV=1
10	P31435	1.19e-06	53.5	460	0.088	0.104	YICJ_ECOLI Inner membrane symporter YicJ OS=Escherichia coli (strain K12) OX=83333 GN=yicJ PE=1 SV=2
11	P02921	4.92e-04	45.1	473	0.072	0.082	MELB_ECOLI Melibiose permease OS=Escherichia coli (strain K12) OX=83333 GN=melB PE=1 SV=2
12	P76350	0.028	39.7	438	0.064	0.080	SHIA_ECOLI Shikimate transporter OS=Escherichia coli (strain K12) OX=83333 GN=shiA PE=2 SV=1
13	P96560	2.3	33.1	409	0.042	0.056	GTFC_AMYOR Glycosyltransferase GtfC OS=Amycolatopsis orientalis OX=31958 GN=gtfC PE=1 SV=1
14	Q6NUT3	2.3	33.5	480	0.079	0.090	MFS12_HUMAN Major facilitator superfamily domain-containing protein 12 OS=Homo sapiens OX=9606 GN=MFSD12 PE=1 SV=2
15	P32137	3.6	32.7	461	0.052	0.061	YIHP_ECOLI Putative 2,3-dihydroxypropane-1-sulfonate exporter OS=Escherichia coli (strain K12) OX=83333 GN=yihP PE=1 SV=3
16	P0A7F9	4.9	32.3	356	0.035	0.053	QUEA_ECOLI S-adenosylmethionine:tRNA ribosyltransferase-isomerase OS=Escherichia coli (strain K12) OX=83333 GN=queA PE=1 SV=1
17	C7BUR8	5.5	32.3	2186	0.046	0.011	C7BUR8_STAAU Surface antigen SasC OS=Staphylococcus aureus OX=1280 GN=sasC PE=4 SV=1
18	F1PZV2	6.3	32.0	478	0.140	0.159	MFS12_CANLF Major facilitator superfamily domain-containing protein 12 OS=Canis lupus familiaris OX=9615 GN=MFSD12 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14316 DUF4381	4.5e+02	12.5	Domain of unknown function (DUF4381)
2	PF13347 MFS_2	7.5e-120	412.0	MFS/sugar transport protein
3	PF06716 MP_p6	3.7e+02	12.6	Movement protein p6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361895

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420174	0.959	Syncytin-2
2	9606.ENSP00000419945	0.688	Syncytin-1
3	9606.ENSP00000283141	0.675	Synaptonemal complex protein 2-like
4	9606.ENSP00000464932	0.671	UNC93-like protein MFSD11
5	9606.ENSP00000479104	0.655	Synaptic vesicle 2-related protein
6	9606.ENSP00000332646	0.638	Major facilitator superfamily domain-containing protein 10
7	9606.ENSP00000403117	0.638	Major facilitator superfamily domain containing 1
8	9606.ENSP00000341785	0.636	Adiponectin receptor protein 1
9	9606.ENSP00000442688	0.632	Molybdate-anion transporter
10	9606.ENSP00000322229	0.624	Fatty acid desaturase 1
11	9606.ENSP00000306328	0.622	Solute carrier family 25 member 33
12	9606.ENSP00000386766	0.609	Zinc transporter ZIP10
13	9606.ENSP00000405482	0.608	Putative transporter SVOPL
14	9606.ENSP00000480890	0.607	Sodium- and chloride-dependent taurine transporter
15	9606.ENSP00000216465	0.593	Maleylacetoacetate isomerase
16	9606.ENSP00000330199	0.590	Sodium-dependent neutral amino acid transporter SLC6A17
17	9606.ENSP00000357840	0.582	Sodium-dependent glucose transporter 1
18	9606.ENSP00000301327	0.577	Major facilitator superfamily domain containing 3
19	9606.ENSP00000258403	0.558	Thiamine transporter 2
20	9606.ENSP00000272542	0.550	Sodium-dependent phosphate transporter 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901505	1.000	carbohydrate derivative transmembrane transporter activity
GO:0015605	1.000	organophosphate ester transmembrane transporter activity
GO:0005548	1.000	phospholipid transporter activity
GO:0005324	1.000	long-chain fatty acid transporter activity
GO:0008028	1.000	monocarboxylic acid transmembrane transporter activity
GO:0005436	1.000	sodium:phosphate symporter activity
GO:0005515	0.991	protein binding
GO:0015245	0.966	fatty acid transmembrane transporter activity
GO:0051978	0.963	lysophospholipid:sodium symporter activity
GO:1901480	0.521	oleate transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.967	cellular process
GO:0015748	0.945	organophosphate ester transport
GO:0010876	0.941	lipid localization
GO:1901264	0.928	carbohydrate derivative transport
GO:0006869	0.898	lipid transport
GO:0015914	0.881	phospholipid transport
GO:0065007	0.823	biological regulation
GO:0050789	0.679	regulation of biological process
GO:0050794	0.635	regulation of cellular process
GO:0032501	0.551	multicellular organismal process
GO:0015711	0.447	organic anion transport
GO:0008152	0.376	metabolic process
GO:0071704	0.371	organic substance metabolic process
GO:0046942	0.367	carboxylic acid transport
GO:0019222	0.360	regulation of metabolic process
GO:0044238	0.330	primary metabolic process
GO:0071840	0.319	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.365	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:33655	0.521	(9Z)-octadecenoate(out) = (9Z)-octadecenoate(in)

[back to server]