StarFunc result for job id Q8NAA5

User Input

>input (344 residues)
MGTRQTKGSLAERASPGAAPGPRRERPDFWASLLLRAGDKAGRAGAGMPPYHRRVGMVQE
LLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYI
HCPKPEGDALGAMEKLCRQLTYHLSPHSQWRRHRGLVKRKPQACLKAVLAGSPPDNTVDL
SGIPLTSRDLERVTSYLQRCGEQVDSVELGFTGLTDDMVLQLLPALSTLPRLTTLALNGN
RLTRAVLRDLTDILKDPSKFPNVTWIDLGNNVDIFSLPQPFLLSLRKRSPKQGHLPTILE
LGEGPGSGEEVREGTVGQEDPGGGPVAPAEDHHEGKETVAAAQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q38C46	0.297	0.080	1.203E-5	1405	0.113	0.028	Q38C46.pdb.gz	Q38C46_TRYB2 CHAT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5860 PE=4 SV=1
2	AFDB:Q57VI9	0.281	0.189	7.971E-5	545	0.154	0.097	Q57VI9.pdb.gz	Q57VI9_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.2F2.540 PE=4 SV=1
3	AFDB:Q38CF8	0.284	0.283	9.835E-5	345	0.122	0.122	Q38CF8.pdb.gz	Q38CF8_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7350 PE=4 SV=1
4	AFDB:Q57ZJ1	0.279	0.248	1.348E-4	395	0.078	0.068	Q57ZJ1.pdb.gz	Q57ZJ1_TRYB2 C3H1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27E10.130 PE=4 SV=1
5	AFDB:Q8I7M7	0.264	0.160	1.847E-4	639	0.137	0.074	Q8I7M7.pdb.gz	Q8I7M7_CAEEL Tropomodulin OS=Caenorhabditis elegans OX=6239 GN=tmd-2 PE=1 SV=3
6	AFDB:Q38A18	0.317	0.106	2.279E-4	1082	0.102	0.032	Q38A18.pdb.gz	Q38A18_TRYB2 Paraflagellar rod component OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0810 PE=4 SV=1
7	AFDB:Q38D82	0.299	0.071	3.293E-4	1578	0.102	0.022	Q38D82.pdb.gz	Q38D82_TRYB2 Flagellar Member 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4280 PE=4 SV=1
8	AFDB:Q383Z2	0.263	0.152	4.062E-4	620	0.116	0.065	Q383Z2.pdb.gz	Q383Z2_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1140 PE=4 SV=1
9	AFDB:D9I2F9	0.285	0.090	1.678E-3	1218	0.166	0.047	D9I2F9.pdb.gz	NL1A1_RAT NACHT, LRR and PYD domains-containing protein 1a allele 1 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
10	AFDB:Q9PUQ6	0.268	0.269	1.864E-3	343	0.096	0.096	Q9PUQ6.pdb.gz	Q9PUQ6_DANRE Sk-tropomodulin OS=Danio rerio OX=7955 GN=Sk-Tmod PE=1 SV=1
11	PDB:5wfnC	0.282	0.464	1.187E-2	193	0.067	0.119	5wfnC.pdb.gz	Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
12	PDB:4rwtD	0.247	0.292	2.230E-2	280	0.084	0.104	4rwtD.pdb.gz	Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
13	PDB:7pzcA	0.256	0.093	3.770E-2	1010	0.073	0.025	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
14	PDB:1a4yA	0.230	0.178	1.198E-1	460	0.084	0.063	1a4yA.pdb.gz
15	PDB:7lfhA	0.193	0.090	2.025E-1	806	0.108	0.046	7lfhA.pdb.gz
16	PDB:4kxfP	0.258	0.110	2.250E-1	866	0.052	0.021	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
17	PDB:3oglB	0.203	0.131	2.371E-1	568	0.064	0.039	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
18	PDB:7ohyb	0.149	0.139	3.425E-1	375	0.113	0.104	7ohyb.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
19	PDB:6npyA	0.215	0.102	4.009E-1	798	0.105	0.045	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
20	PDB:6ylgb	0.151	0.096	4.009E-1	613	0.110	0.062	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78395	4.48e-05	47.4	509	0.084	0.057	PRAME_HUMAN Melanoma antigen preferentially expressed in tumors OS=Homo sapiens OX=9606 GN=PRAME PE=1 SV=1
2	Q5VXH4	2.82e-04	45.1	476	0.087	0.063	PRAM6_HUMAN PRAME family member 6 OS=Homo sapiens OX=9606 GN=PRAMEF6 PE=1 SV=1
3	P0DUQ2	3.28e-04	44.7	478	0.087	0.063	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
4	Q2LKU9	0.055	38.1	1182	0.081	0.024	NLR1A_MOUSE NACHT, LRR and PYD domains-containing protein 1a OS=Mus musculus OX=10090 GN=Nlrp1a PE=1 SV=1
5	P59047	0.36	35.4	1200	0.067	0.019	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
6	Q2LKV2	0.61	34.7	906	0.081	0.031	NL1B4_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 4 OS=Mus musculus OX=10090 GN=Nlrp1b PE=2 SV=1
7	Q9FL28	0.75	34.3	1173	0.064	0.019	FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana OX=3702 GN=FLS2 PE=1 SV=1
8	Q2LKV5	0.76	34.3	1172	0.081	0.024	NL1B3_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 3 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
9	Q2LKW6	0.78	34.3	1233	0.081	0.023	NL1B1_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 1 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
10	Q9LYN8	0.92	33.9	1192	0.067	0.019	EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana OX=3702 GN=EMS1 PE=1 SV=1
11	Q9C9Q1	0.97	33.1	242	0.047	0.066	Q9C9Q1_ARATH Histone deacetylase complex subunit OS=Arabidopsis thaliana OX=3702 GN=AFR1 PE=2 SV=1
12	Q0GKD5	1.3	33.5	1196	0.099	0.028	NL1B5_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 5 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
13	F4HP43	1.7	32.7	248	0.047	0.065	F4HP43_ARATH Histone deacetylase complex subunit OS=Arabidopsis thaliana OX=3702 GN=AFR2 PE=1 SV=1
14	O88280	1.8	33.1	1523	0.116	0.026	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
15	Q647I9	1.9	33.1	1098	0.064	0.020	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
16	M9PBD9	2.1	32.7	596	0.047	0.027	M9PBD9_DROME Ran GTPase activating protein, isoform B OS=Drosophila melanogaster OX=7227 GN=RanGAP PE=1 SV=1
17	Q9SMH5	2.1	33.1	4334	0.116	0.009	DYHC2_CHLRE Cytoplasmic dynein 2 heavy chain 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1B PE=1 SV=2
18	Q9VIW3	2.1	32.7	596	0.047	0.027	RAGP1_DROME Ran GTPase-activating protein OS=Drosophila melanogaster OX=7227 GN=RanGAP PE=1 SV=1
19	Q6Q4D0	2.3	32.7	1311	0.061	0.016	TONS_ARATH Protein TONSOKU OS=Arabidopsis thaliana OX=3702 GN=TSK PE=1 SV=2
20	Q99MW3	2.4	32.3	458	0.064	0.048	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12799 LRR_4	5.4e+02	12.5	Leucine Rich repeats (2 copies)
2	PF03934 T2SSK	78	14.1	Type II secretion system (T2SS), protein K

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419502

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483005	0.707	Tripartite motif containing 52
2	9606.ENSP00000377411	0.573	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2
3	9606.ENSP00000368030	0.570	ATPase family AAA domain-containing protein 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.481	catalytic activity
GO:0042802	0.358	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.979	regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0050896	0.784	response to stimulus
GO:0048583	0.761	regulation of response to stimulus
GO:0008152	0.586	metabolic process
GO:0009605	0.578	response to external stimulus
GO:0071704	0.563	organic substance metabolic process
GO:0044238	0.527	primary metabolic process
GO:0006807	0.498	nitrogen compound metabolic process
GO:0043170	0.483	macromolecule metabolic process
GO:0009966	0.480	regulation of signal transduction
GO:0019538	0.463	protein metabolic process
GO:0048519	0.393	negative regulation of biological process
GO:0048522	0.392	positive regulation of cellular process
GO:0060255	0.387	regulation of macromolecule metabolic process
GO:0048523	0.383	negative regulation of cellular process
GO:0009987	0.372	cellular process
GO:0010468	0.358	regulation of gene expression
GO:0006950	0.341	response to stress
GO:0051707	0.338	response to other organism
GO:0051128	0.334	regulation of cellular component organization
GO:0051171	0.306	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005634	0.916	nucleus
GO:0032991	0.723	protein-containing complex
GO:0016020	0.706	membrane
GO:0005739	0.614	mitochondrion
GO:0031974	0.385	membrane-enclosed lumen
GO:0070013	0.365	intracellular organelle lumen
GO:0043228	0.307	non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]